KEGG   Manis javanica (Malayan pangolin): 108405695
Entry
108405695         CDS       T06054                                 

Definition
(RefSeq) tyrosine-protein phosphatase non-receptor type 11-like
  KO
K07293  tyrosine-protein phosphatase non-receptor type 11 [EC:3.1.3.48]
Organism
mjv  Manis javanica (Malayan pangolin)
Pathway
mjv04014  Ras signaling pathway
mjv04072  Phospholipase D signaling pathway
mjv04360  Axon guidance
mjv04625  C-type lectin receptor signaling pathway
mjv04630  JAK-STAT signaling pathway
mjv04650  Natural killer cell mediated cytotoxicity
mjv04670  Leukocyte transendothelial migration
mjv04722  Neurotrophin signaling pathway
mjv04920  Adipocytokine signaling pathway
mjv04931  Insulin resistance
mjv05168  Herpes simplex virus 1 infection
mjv05205  Proteoglycans in cancer
mjv05211  Renal cell carcinoma
mjv05220  Chronic myeloid leukemia
mjv05235  PD-L1 expression and PD-1 checkpoint pathway in cancer
Brite
KEGG Orthology (KO) [BR:mjv00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04014 Ras signaling pathway
    108405695
   04630 JAK-STAT signaling pathway
    108405695
   04072 Phospholipase D signaling pathway
    108405695
 09150 Organismal Systems
  09151 Immune system
   04625 C-type lectin receptor signaling pathway
    108405695
   04650 Natural killer cell mediated cytotoxicity
    108405695
   04670 Leukocyte transendothelial migration
    108405695
  09152 Endocrine system
   04920 Adipocytokine signaling pathway
    108405695
  09156 Nervous system
   04722 Neurotrophin signaling pathway
    108405695
  09158 Development and regeneration
   04360 Axon guidance
    108405695
 09160 Human Diseases
  09161 Cancer: overview
   05205 Proteoglycans in cancer
    108405695
   05235 PD-L1 expression and PD-1 checkpoint pathway in cancer
    108405695
  09162 Cancer: specific types
   05220 Chronic myeloid leukemia
    108405695
   05211 Renal cell carcinoma
    108405695
  09167 Endocrine and metabolic disease
   04931 Insulin resistance
    108405695
  09172 Infectious disease: viral
   05168 Herpes simplex virus 1 infection
    108405695
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01009 Protein phosphatases and associated proteins [BR:mjv01009]
    108405695
Enzymes [BR:mjv01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.3  Phosphoric-monoester hydrolases
    3.1.3.48  protein-tyrosine-phosphatase
     108405695
Protein phosphatases and associated proteins [BR:mjv01009]
 Protein tyrosine phosphatases (PTPs)
  Class I PTPs (Classical)
   Non-receptor PTPs
    108405695
SSDB
Motif
Pfam: Y_phosphatase SH2 DSPc Y_phosphatase3 PTPlike_phytase
Other DBs
NCBI-GeneID: 108405695
NCBI-ProteinID: XP_017529467
LinkDB
Position
Unknown
AA seq 594 aa
MASRRWFHPNIGGFEAEKLLLSRGQHGSFLARPSKSCPGGFTLSVRRHDEVTHIKIQNTG
DYYDLYGGEKFATLAELVQHYTGQHGGLLRERSGAPVELRHPLGCQDPTSERWYHGHLSG
KEAEKLLMEKGRVGSFLVRESQSKPGDFVLSVLTQQPDKVDCQPRVTHIMIHFQPDGKYD
VGGGEQFDTLKDLVECYRKNPMVEKSGAVVHLKQPLKATRINATSMESRVQELSKATETG
DKAKQGFWEEFEMLQQQECRLLYPRKEGQRLENKPKNRYKNILPFDATRVSLRDVDNSVP
GADYINANYIKSDPEEKPGQGLGKVYIATQGCLQTTVAAFWAMLYQENTQVIVMTTREVE
RGRNKCFRYWPDPHGSQEHGCVRVCNLAENQAHGYCVRELQVWRSDQEGPPRTVKHYQYF
SWPDHGVPAEPAGVLDFLDDVNQAQSSTSGAGPMVVHCSAGIGRTGTIIVIDILVGLLRR
HGLDCDIDVPRTIQLVRRQRSGMVQTEAQYKFVYLALQRYIQGEQLRLREQVRAGRGRGG
HALTSPRLRHPLQSCFSPAHSTGLGRGPGCTGPLLCPGLARPSPCGCVRTMLAG
NT seq 1785 nt   +upstreamnt  +downstreamnt
atggcctcgcgcaggtggtttcaccccaacatcggtgggtttgaggcagagaagctgctc
ctgtccaggggccagcacggaagcttcttggcaagacccagcaagagctgtcccgggggc
ttcacactgtccgtcaggcgccacgatgaggtcacccacatcaagatccagaacacgggc
gactactacgacctgtatggcggggagaagttcgcaaccctggcggagctggtgcagcac
tacacaggccagcacgggggtctgctccgggagcgcagcggggcgcctgtggagctccgg
caccccctgggttgccaggaccccacgtcagagcgctggtaccacgggcacctgtctggc
aaggaggctgagaagctgctaatggagaaggggcgtgtgggcagcttcctggtacgagag
agtcagagcaaacctggggactttgtgctgtctgtgctcacacagcagccagacaaggtg
gactgccagccccgggtcacccacatcatgatccacttccagccagatgggaagtatgac
gtgggaggtggggaacagttcgacaccctcaaagacctggtcgagtgctacaggaagaac
cccatggtggagaagtcgggggctgtggtgcacctcaagcagcccctcaaggccacgagg
atcaatgccacaagcatggagagccgcgtgcaggagctcagcaaggccacggaaaccggc
gacaaggccaagcagggcttctgggaggagtttgagatgctgcagcagcaggaatgccgg
ctcctgtatccccggaaggaggggcagcggctggagaacaagcccaagaatcgctacaag
aacatccttcctttcgatgccacccgcgtcagcctgcgtgacgtggacaacagcgtgcct
ggagctgactacatcaatgccaactacatcaagagtgacccagaagagaagccaggtcag
ggactgggcaaggtgtacattgccacccagggctgcctgcagactacagtggctgccttc
tgggccatgttgtaccaggagaacacgcaggtcattgtcatgaccacccgggaggtggag
cgaggccggaacaaatgcttccgatactggccagacccacatggcagccaagaacatggc
tgtgtgcgtgtgtgcaacttggctgaaaaccaggcccatggctactgtgtgagggagctg
caggtgtggcggtcagaccaggaggggccgccgcgcaccgtgaagcactaccagtacttc
agctggcccgaccatggggtccccgccgagcccgccggcgtcctagacttcctggacgac
gtgaaccaggcccagagcagcacgtccggggccgggcccatggtggtgcactgcagcgcc
ggcatcggacgcactggcactatcatcgtgattgacatcctggtggggctcctccgcagg
cacgggctggactgcgacatcgacgtccccaggacgattcagctggtgcggcggcagcgc
tcggggatggtgcagaccgaggcgcagtacaagtttgtgtacctggcgctgcagcggtac
atccagggcgagcagctgcgcctgcgcgagcaggtgcgagcggggcgggggcggggaggg
catgcgctgacgtcaccgcgactgcgccacccgcttcagagctgcttcagccctgcccac
agcaccggcctgggtcgcggccctggctgcactgggcccctgctgtgtccgggcctggcc
aggccctcgccttgcggctgcgtgaggacaatgcttgcgggatga

DBGET integrated database retrieval system