KEGG   Manis javanica (Malayan pangolin): 108406216
Entry
108406216         CDS       T06054                                 

Gene name
PTGS2
Definition
(RefSeq) prostaglandin G/H synthase 2
  KO
K11987  prostaglandin-endoperoxide synthase 2 [EC:1.14.99.1]
Organism
mjv  Manis javanica (Malayan pangolin)
Pathway
mjv00590  Arachidonic acid metabolism
mjv01100  Metabolic pathways
mjv04064  NF-kappa B signaling pathway
mjv04370  VEGF signaling pathway
mjv04625  C-type lectin receptor signaling pathway
mjv04657  IL-17 signaling pathway
mjv04668  TNF signaling pathway
mjv04723  Retrograde endocannabinoid signaling
mjv04726  Serotonergic synapse
mjv04913  Ovarian steroidogenesis
mjv04921  Oxytocin signaling pathway
mjv04923  Regulation of lipolysis in adipocytes
mjv05010  Alzheimer disease
mjv05022  Pathways of neurodegeneration - multiple diseases
mjv05140  Leishmaniasis
mjv05163  Human cytomegalovirus infection
mjv05165  Human papillomavirus infection
mjv05167  Kaposi sarcoma-associated herpesvirus infection
mjv05200  Pathways in cancer
mjv05204  Chemical carcinogenesis
mjv05206  MicroRNAs in cancer
mjv05222  Small cell lung cancer
Brite
KEGG Orthology (KO) [BR:mjv00001]
 09100 Metabolism
  09103 Lipid metabolism
   00590 Arachidonic acid metabolism
    108406216 (PTGS2)
 09130 Environmental Information Processing
  09132 Signal transduction
   04370 VEGF signaling pathway
    108406216 (PTGS2)
   04064 NF-kappa B signaling pathway
    108406216 (PTGS2)
   04668 TNF signaling pathway
    108406216 (PTGS2)
 09150 Organismal Systems
  09151 Immune system
   04625 C-type lectin receptor signaling pathway
    108406216 (PTGS2)
   04657 IL-17 signaling pathway
    108406216 (PTGS2)
  09152 Endocrine system
   04923 Regulation of lipolysis in adipocytes
    108406216 (PTGS2)
   04913 Ovarian steroidogenesis
    108406216 (PTGS2)
   04921 Oxytocin signaling pathway
    108406216 (PTGS2)
  09156 Nervous system
   04726 Serotonergic synapse
    108406216 (PTGS2)
   04723 Retrograde endocannabinoid signaling
    108406216 (PTGS2)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    108406216 (PTGS2)
   05206 MicroRNAs in cancer
    108406216 (PTGS2)
   05204 Chemical carcinogenesis
    108406216 (PTGS2)
  09162 Cancer: specific types
   05222 Small cell lung cancer
    108406216 (PTGS2)
  09164 Neurodegenerative disease
   05010 Alzheimer disease
    108406216 (PTGS2)
   05022 Pathways of neurodegeneration - multiple diseases
    108406216 (PTGS2)
  09172 Infectious disease: viral
   05163 Human cytomegalovirus infection
    108406216 (PTGS2)
   05167 Kaposi sarcoma-associated herpesvirus infection
    108406216 (PTGS2)
   05165 Human papillomavirus infection
    108406216 (PTGS2)
  09174 Infectious disease: parasitic
   05140 Leishmaniasis
    108406216 (PTGS2)
Enzymes [BR:mjv01000]
 1. Oxidoreductases
  1.14  Acting on paired donors, with incorporation or reduction of molecular oxygen
   1.14.99  Miscellaneous
    1.14.99.1  prostaglandin-endoperoxide synthase
     108406216 (PTGS2)
SSDB
Motif
Pfam: An_peroxidase EGF Toxin_27
Other DBs
NCBI-GeneID: 108406216
NCBI-ProteinID: XP_017530298
LinkDB
Position
Unknown
AA seq 604 aa
MLARALLLCAALALCHAANPCCSNPCQNRGVCMSVGFDQYKCDCTRTGFSGENCSTPEFL
TKIKLLLKPTPNTVHYILTHFKGVWNIVNNIPFLRNAIMKYVLTSRSHLIDSPPTYNAHY
GYKSWEAFSNLSYYTRALPPVADNCPTPMGVKGKKELPDSKELVEKFLLRRKFIPDPQGT
NMMFAFFAQHFTHQFFKTDHRRGPAFTKGLGHGVDLNHVYGETLDRQHKLRLFKDGKMKY
QIVDGEMYPPTVKDTQVKMIYPPHVPEHLQFAVGQEVFGLVPGLMMYATIWLREHNRVCD
VLKQEHPEWDDEQLFQTSRLILIGETIKIVIEDYVQHLSGYHFKLKFDPELLFNQQFQYQ
NRIAAEFNTLYHWHPLLPDTFQIDDQEYNYQQFVYNNSILLGHGLTQFVESFSRQIAGRV
AGGRNVSPAVQQVAKASIDQSRQMKYQSLNEYRKRFLMKPYQSFEELTGEKEMAAELEAL
YGDIDAMELYPALLVEKPRPDAIFGETMVELGAPFSLKGLMGNPICSPEYWKPSTFGGEV
GFKIINTASIQSLICKNVKGCPFTSFSVQDQQLTKTATINVSSSHSGLDDINPTVLLKER
STEL
NT seq 1815 nt   +upstreamnt  +downstreamnt
atgctcgcccgcgctctgctgctgtgcgccgccctggcgctctgccacgcagcaaatcct
tgctgttcgaacccatgtcaaaaccgtggtgtatgcatgagcgtaggatttgaccagtat
aagtgtgactgtacccgaacaggattctctggtgaaaactgctcaacacctgaatttctg
acaaaaataaaattactgctgaagcccactccaaacacagtgcactacatacttacccac
ttcaagggagtctggaacattgtcaataacattcccttcctgagaaatgcaatcatgaaa
tatgtgttgacatccagatcacatttgattgacagcccaccaacttacaatgcacactat
ggctacaaaagctgggaagccttttctaatctttcctattataccagagctcttcctcct
gtggctgacaactgcccaacacccatgggtgtgaaagggaagaaagagcttcctgattca
aaagagctagtggaaaaatttcttctaagaaggaagttcatccctgatccccagggcaca
aatatgatgtttgcattctttgcccagcacttcacacatcaatttttcaagacagatcat
aggcgaggaccagctttcaccaaaggactgggccatggggtggacttaaatcatgtttat
ggtgaaactttggatagacagcataaactacgccttttcaaggatggaaaaatgaaatat
cagatagttgatggagagatgtatcctcccacagtcaaagatactcaggtcaagatgatc
tacccgcctcacgtccctgaacatctgcagtttgctgtgggccaggaggtctttggcctg
gtgcctggtctgatgatgtatgccacaatttggcttcgggaacataacagagtatgtgat
gtacttaaacaagagcatccagaatgggacgatgagcagttattccagacgagcaggcta
atactgataggagaaactattaagattgtgattgaagactatgtacaacacttgagtggc
tatcacttcaaactgaagttcgacccagagctgcttttcaaccaacaatttcagtaccaa
aaccgaattgctgctgagtttaatacactctaccactggcatccccttctgcctgacacc
tttcaaattgacgaccaggaatacaactatcaacagtttgtctacaacaactctatatta
ctgggacatggactcacccagtttgttgaatcattcagcaggcaaattgctggcagggtt
gctggtggcaggaatgtttcacctgcagtacaacaagtagctaaggcctccattgaccag
agcagacagatgaaataccagtctcttaatgagtaccgcaaacgcttcctaatgaagccc
taccaatcatttgaagaactaacaggagagaaggaaatggctgcggagttagaagccctc
tatggtgacattgatgccatggagctgtatcctgcccttttggtagaaaagcctcgccca
gatgccatttttggtgagaccatggtagaacttggagcaccattttccctgaaaggactt
atgggtaatcccatatgttctcctgagtactggaagcctagcacttttggtggagaagta
ggttttaaaatcatcaacactgcctcaattcaatctctcatctgcaagaatgtgaagggc
tgtccttttacttcattcagtgttcaagatcaacagctcaccaagacagccaccattaat
gtaagctcttctcactctggactagatgacatcaatcccacagtactactaaaagaacgt
tcaactgaactgtag

DBGET integrated database retrieval system