KEGG   Manis javanica (Malayan pangolin): 108406292
Entry
108406292         CDS       T06054                                 

Definition
(RefSeq) epidermal growth factor receptor-like isoform X1
  KO
K04361  epidermal growth factor receptor [EC:2.7.10.1]
Organism
mjv  Manis javanica (Malayan pangolin)
Pathway
mjv01521  EGFR tyrosine kinase inhibitor resistance
mjv01522  Endocrine resistance
mjv04010  MAPK signaling pathway
mjv04012  ErbB signaling pathway
mjv04014  Ras signaling pathway
mjv04015  Rap1 signaling pathway
mjv04020  Calcium signaling pathway
mjv04066  HIF-1 signaling pathway
mjv04068  FoxO signaling pathway
mjv04072  Phospholipase D signaling pathway
mjv04144  Endocytosis
mjv04151  PI3K-Akt signaling pathway
mjv04510  Focal adhesion
mjv04520  Adherens junction
mjv04540  Gap junction
mjv04630  JAK-STAT signaling pathway
mjv04810  Regulation of actin cytoskeleton
mjv04912  GnRH signaling pathway
mjv04915  Estrogen signaling pathway
mjv04921  Oxytocin signaling pathway
mjv04926  Relaxin signaling pathway
mjv04928  Parathyroid hormone synthesis, secretion and action
mjv04934  Cushing syndrome
mjv05160  Hepatitis C
mjv05163  Human cytomegalovirus infection
mjv05165  Human papillomavirus infection
mjv05171  Coronavirus disease - COVID-19
mjv05200  Pathways in cancer
mjv05205  Proteoglycans in cancer
mjv05206  MicroRNAs in cancer
mjv05210  Colorectal cancer
mjv05212  Pancreatic cancer
mjv05213  Endometrial cancer
mjv05214  Glioma
mjv05215  Prostate cancer
mjv05218  Melanoma
mjv05219  Bladder cancer
mjv05223  Non-small cell lung cancer
mjv05224  Breast cancer
mjv05225  Hepatocellular carcinoma
mjv05226  Gastric cancer
mjv05230  Central carbon metabolism in cancer
mjv05231  Choline metabolism in cancer
mjv05235  PD-L1 expression and PD-1 checkpoint pathway in cancer
Brite
KEGG Orthology (KO) [BR:mjv00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    108406292
   04012 ErbB signaling pathway
    108406292
   04014 Ras signaling pathway
    108406292
   04015 Rap1 signaling pathway
    108406292
   04630 JAK-STAT signaling pathway
    108406292
   04066 HIF-1 signaling pathway
    108406292
   04068 FoxO signaling pathway
    108406292
   04020 Calcium signaling pathway
    108406292
   04072 Phospholipase D signaling pathway
    108406292
   04151 PI3K-Akt signaling pathway
    108406292
 09140 Cellular Processes
  09141 Transport and catabolism
   04144 Endocytosis
    108406292
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    108406292
   04520 Adherens junction
    108406292
   04540 Gap junction
    108406292
  09142 Cell motility
   04810 Regulation of actin cytoskeleton
    108406292
 09150 Organismal Systems
  09152 Endocrine system
   04912 GnRH signaling pathway
    108406292
   04915 Estrogen signaling pathway
    108406292
   04921 Oxytocin signaling pathway
    108406292
   04926 Relaxin signaling pathway
    108406292
   04928 Parathyroid hormone synthesis, secretion and action
    108406292
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    108406292
   05206 MicroRNAs in cancer
    108406292
   05205 Proteoglycans in cancer
    108406292
   05230 Central carbon metabolism in cancer
    108406292
   05231 Choline metabolism in cancer
    108406292
   05235 PD-L1 expression and PD-1 checkpoint pathway in cancer
    108406292
  09162 Cancer: specific types
   05210 Colorectal cancer
    108406292
   05212 Pancreatic cancer
    108406292
   05225 Hepatocellular carcinoma
    108406292
   05226 Gastric cancer
    108406292
   05214 Glioma
    108406292
   05218 Melanoma
    108406292
   05219 Bladder cancer
    108406292
   05215 Prostate cancer
    108406292
   05213 Endometrial cancer
    108406292
   05224 Breast cancer
    108406292
   05223 Non-small cell lung cancer
    108406292
  09167 Endocrine and metabolic disease
   04934 Cushing syndrome
    108406292
  09172 Infectious disease: viral
   05160 Hepatitis C
    108406292
   05171 Coronavirus disease - COVID-19
    108406292
   05163 Human cytomegalovirus infection
    108406292
   05165 Human papillomavirus infection
    108406292
  09176 Drug resistance: antineoplastic
   01521 EGFR tyrosine kinase inhibitor resistance
    108406292
   01522 Endocrine resistance
    108406292
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:mjv01001]
    108406292
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:mjv04147]
    108406292
Enzymes [BR:mjv01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.10  Protein-tyrosine kinases
    2.7.10.1  receptor protein-tyrosine kinase
     108406292
Protein kinases [BR:mjv01001]
 Receptor tyrosine kinases (RTK)
  EGFR family [OT]
   108406292
Exosome [BR:mjv04147]
 Exosomal proteins
  Exosomal proteins of colorectal cancer cells
   108406292
  Exosomal proteins of pancreatic cancer cells
   108406292
  Exosomal proteins of bladder cancer cells
   108406292
SSDB
Motif
Pfam: Recep_L_domain GF_recep_IV Furin-like Borrelia_P83
Other DBs
NCBI-GeneID: 108406292
NCBI-ProteinID: XP_017530403
LinkDB
Position
Unknown
AA seq 681 aa
MPSVKVTGWRPSHNDTVTGFMRAGECSCCLWEHSQQSLIETAFLGSRNNLKRVDAMWKVC
QGTSNKLTQLGTFEDHFLSLQRMFNNCEVVLGNLEITYMQRNYDLSFLKTIQEVAGYVLI
ALNTVEKIPLENLQIIRGNVLYENTHALSVLSNYGVNKTGLQELPLRSLQEILQGAVRFS
NNPVLCSVDTIQWRDIINGDFLGNMSMDFQNPLGSCQKCDPGCPNGSCWGAGKENCQKLT
KLICAQQCSGRCRGKSPSDCCHNQCAAGCTGPRESDCLVCRRFRDEATCKDTCPPLMLYN
PTTYQMDVNPEGKYSFGATCVKKCPRNYVVTDHGSCVRACSSDSYEVEEEGVRKCKKCEG
PCRKVCNGIGIGEFKDTLSINATNIKHFKNCTSISGDLHILPVAFRGDSFTRTPPLDPKE
LDILKTVKEITGFLLIQAWPENRTDLHAFENLEVIRGRTKQHGQFSLAVVGLDIKSLGLR
SLKEISDGDVIISGNQNLCYANTIHWKKLFGTSSQKTKIINNKGEKDCKAIGHICNSLCS
SEGCWGPEPKDCVSCRNVSRGRECVEKCNVLEGEPREFVENSQCIQCHPECLPQTMNITC
TGHGPDSCVKCAHYIDGPHCVKTCPAGVMGENNTLVWKFADANHVCRLCHSNCTYGKLII
SSSIMASSSLFHKFQIVLKGP
NT seq 2046 nt   +upstreamnt  +downstreamnt
atgccaagtgttaaggtgactggctggagaccatcccataatgacaccgtcacaggcttc
atgcgggccggagagtgttcgtgctgcctctgggaacacagtcaacagtccctcatagaa
acggccttcctgggatcgagaaacaacctaaagagagtggacgcaatgtggaaagtttgc
cagggcacaagtaacaagctcacccagttgggcacttttgaagaccactttctgagcctc
cagaggatgttcaataactgtgaggtggtcctggggaacttggaaattacttacatgcaa
aggaattatgacctttccttcttaaagactatccaggaggttgccggctatgtactcatt
gctctcaatacagtggagaaaattcctttggaaaacctgcagatcatcaggggaaacgtg
ctctatgaaaacacccatgccttatcagtcttatccaactatggtgtcaacaaaactgga
ctgcaagagctgcccctgaggagcttacaggaaatactgcaaggtgctgtgcgcttcagc
aacaacccggtcctctgcagtgtggacaccatccagtggagggacatcatcaacggtgac
ttcctgggcaacatgtcgatggactttcagaacccactgggcagctgccaaaagtgtgat
ccaggctgccccaatggaagctgctggggtgctgggaaggagaactgccagaaactgacc
aagctcatctgtgcccagcagtgttcagggcgctgccgcggcaagtcccccagcgattgc
tgtcacaaccagtgtgccgcaggctgcacagggccccgggagagcgactgcctggtctgc
cgcaggttccgtgatgaagccacgtgcaaggacacctgcccaccgctcatgctgtacaac
cccaccacgtaccagatggacgtgaacccagagggaaagtacagcttcggtgccacctgt
gtgaagaaatgcccccgtaactacgtggtgacagaccatggctcctgcgtccgcgcctgc
agttccgacagctacgaggtggaggaggagggtgtccgcaaatgtaaaaagtgtgaaggg
ccttgtcgcaaagtttgtaatggaataggaattggtgaatttaaagacacactttccata
aatgctacaaatattaaacacttcaaaaattgcacctcaatcagtggagatcttcatatc
ctgccggtggcatttaggggggactccttcacacgtactccacctctggatccaaaggaa
ctggatatcctaaaaactgtgaaggagatcacagggttcttgctaattcaggcctggcca
gaaaacaggactgacctccatgcatttgagaacctagaggtcatacgtggaagaacaaag
caacatggccagttttctctcgcagttgtcggcctggacataaagtccttgggattacgt
tccctcaaggagataagtgatggcgatgtgataatttcaggaaatcaaaacttgtgctat
gcaaatacaatacactggaaaaaattgtttgggacatcaagtcagaaaaccaaaattata
aacaacaaaggtgaaaaagactgcaaggctataggccacatctgtaactcattatgctca
tcagagggctgctggggcccggagcctaaggactgtgtgtcctgccgaaacgtcagccgc
ggcagggaatgtgtggagaagtgcaacgttctggagggtgagccgagggagtttgtggag
aattcccagtgcatacagtgccatccagaatgcctgccccagaccatgaatataacctgc
acgggacacggaccagacagctgtgtaaagtgtgcccactacatcgatggcccacactgc
gtcaagacctgccccgctggagtcatgggggaaaacaataccctggtctggaagtttgcg
gatgccaatcacgtgtgccgtctgtgccattcaaactgtacctacgggaaactgatcata
tcttcttcaataatggcatcttcatctctcttccacaagtttcagattgtattaaaagga
ccataa

DBGET integrated database retrieval system