KEGG   Manis javanica (Malayan pangolin): 108406748
Entry
108406748         CDS       T06054                                 

Gene name
APAF1
Definition
(RefSeq) apoptotic protease-activating factor 1 isoform X1
  KO
K02084  apoptotic protease-activating factor
Organism
mjv  Manis javanica (Malayan pangolin)
Pathway
mjv01524  Platinum drug resistance
mjv04115  p53 signaling pathway
mjv04210  Apoptosis
mjv04215  Apoptosis - multiple species
mjv05010  Alzheimer disease
mjv05012  Parkinson disease
mjv05014  Amyotrophic lateral sclerosis
mjv05016  Huntington disease
mjv05020  Prion disease
mjv05022  Pathways of neurodegeneration - multiple diseases
mjv05134  Legionellosis
mjv05152  Tuberculosis
mjv05160  Hepatitis C
mjv05161  Hepatitis B
mjv05162  Measles
mjv05164  Influenza A
mjv05168  Herpes simplex virus 1 infection
mjv05169  Epstein-Barr virus infection
mjv05200  Pathways in cancer
mjv05222  Small cell lung cancer
Brite
KEGG Orthology (KO) [BR:mjv00001]
 09140 Cellular Processes
  09143 Cell growth and death
   04210 Apoptosis
    108406748 (APAF1)
   04215 Apoptosis - multiple species
    108406748 (APAF1)
   04115 p53 signaling pathway
    108406748 (APAF1)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    108406748 (APAF1)
  09162 Cancer: specific types
   05222 Small cell lung cancer
    108406748 (APAF1)
  09164 Neurodegenerative disease
   05010 Alzheimer disease
    108406748 (APAF1)
   05012 Parkinson disease
    108406748 (APAF1)
   05014 Amyotrophic lateral sclerosis
    108406748 (APAF1)
   05016 Huntington disease
    108406748 (APAF1)
   05020 Prion disease
    108406748 (APAF1)
   05022 Pathways of neurodegeneration - multiple diseases
    108406748 (APAF1)
  09171 Infectious disease: bacterial
   05134 Legionellosis
    108406748 (APAF1)
   05152 Tuberculosis
    108406748 (APAF1)
  09172 Infectious disease: viral
   05161 Hepatitis B
    108406748 (APAF1)
   05160 Hepatitis C
    108406748 (APAF1)
   05164 Influenza A
    108406748 (APAF1)
   05162 Measles
    108406748 (APAF1)
   05168 Herpes simplex virus 1 infection
    108406748 (APAF1)
   05169 Epstein-Barr virus infection
    108406748 (APAF1)
  09176 Drug resistance: antineoplastic
   01524 Platinum drug resistance
    108406748 (APAF1)
SSDB
Motif
Pfam: WD40 NB-ARC APAF1_C ANAPC4_WD40 CARD WD40_like Ge1_WD40 CARD_2 Nup160 AAA_16 Utp8 AAA_22 AAA_18
Other DBs
NCBI-GeneID: 108406748
NCBI-ProteinID: XP_017531112
LinkDB
Position
Unknown
AA seq 1248 aa
MDAKARNCLLQHRKALEKDIKTSYIMDYMISDGGLTISEEEKVRNEPTQQRAAVLINLIL
KKDNSAYISFYNALLHEGYKDLAALLHGGIPVVSSNNGKDSGGGITSYVRTVLCEGGVPQ
RPVVFVTRKKLVDAIQQKLRRLNGEPGWVTIYGMAGCGKSVLAAEAVRDHFFLVGHFPRG
VHWVSIGKQDKSGLLMKLQNLCSRLDQDESFSQRLPLNIEEAKDRLRILMLHKYPRSLLI
LDDVWDPWVLKAFDNQCQILLTTRDKSVTDLVTGPKYVVPVESGLGKDKGLEILSLFVNM
KKSELPEEAHSIIKECRGSPLVVSLIGALLRDFPNRWAYYLRQLQIKQFKRIRKSSSYDY
EALDEAMSISVDMLREDIKGYYTDLSILKKDVKVPTKVLCILWDMENEEVEDILQEFVNK
SLLFCDRNGNSFCYYLHDLQIDFLTEKNCNQLQDLHKKLITQFQRHHQLHTLSPDQEDCM
YWYNFLAYHMASAKMHKELCALMLSLDWIKAKTELVGPAHLIHEFVEYRHILDEKECAVC
ENFQEFLSLNGHLLGRQPFPNIVQLGLCEPATSEVYQQAKLRAKQEVDNGMLYLEWINKE
NIKNLSRLVVRPHTDAVYHACFSKDGQRIASCGADKTLQVFKAETGEKLLEIHAHEDEVL
CCAFSSDDRFIATCSVDKKVKIWNYMTGELVHTYDEHSEQVNCCHFTNNSHHLLLATGSN
DHLIKLWDLNQKHCRNTLFGHTNSVIHCRFSPDDKLLASCSADGTLKLWDVKSANDRKSI
NMKQFFLNSEEPQEDMEVIVKCCSWSSDGASIMVAAKSKIFLFDIHTTGLLAEIHIGHYS
TIQYCDFSPSSRLAVVALSQYCVELWNMDSRLKVADCRGHLSWVHCVMFSPDGSSFLTSS
DDQTIRLWETKKVCENSAVVLKQEIDAVFQENEVMVLGVDNIRRLQLINGKTGQIDYLTE
AQVSCCCLSPHLQYIAFGGEDGAIEILELLNNRIFQSRSGHKKTVQHMQFTADEKTLISS
SDDSSIQVWNWQSGEYVFLEAHQETVKDFRLLKNSRLLSWSFDGTVKVWNIITGRIEKDF
VCHQDTVLSCAVSSDATKFSSTSTDKTAKVWSFELPSPLHELKGHKGCVRCSVFSVDSTL
LATGDDNGEIRIWSVSDGELLHLCAPISVEGGAATHGGWVTDLCFSPDSKMLVSAGGYLK
WWNVVTGESSQTFYTNGTNLKKIHVSSDFKTYVTVDNLGILYILQILE
NT seq 3747 nt   +upstreamnt  +downstreamnt
atggatgcaaaagctcgaaattgtttacttcaacacagaaaagccctggaaaaggacatc
aaaacatcctacatcatggattacatgattagtgatggaggtttaacaatatcagaagag
gaaaaagtaagaaatgagcccactcagcaacgagcagctgtgctaattaatctgatactt
aaaaaagataattctgcctatatatcattctacaatgctctactacatgaagggtataaa
gatctcgctgcccttctccatggtggtattcctgttgtctcttctaacaatggcaaagat
tctggtggtggaataacttcatatgtaaggactgtcctatgtgaaggtggagtgccacag
aggccagtggtttttgttactaggaagaagctggtggatgcaattcagcagaagctcagg
agactgaacggtgaaccgggatgggtcaccatatatggaatggcaggttgtgggaagtct
gtgttagcagcagaagctgttcgagatcatttcttcttagtcggtcacttccccaggggt
gtgcattgggtttcaattgggaaacaagacaaatctggcctcctgatgaaactgcagaat
ctttgctcacggttggatcaggatgagagtttctcccagaggcttccacttaatattgaa
gaggctaaagaccgtcttcgaattctgatgttgcacaaatacccaaggtctctgttgatc
ttggatgatgtttgggatccttgggtgttaaaagcttttgacaatcagtgtcagattctt
cttacaaccagagacaagagtgttacagatttagtaacaggtcccaaatatgtagtccct
gtggagagtggcttaggaaaagacaaaggacttgaaattttatcactttttgtaaatatg
aagaaatcagaattgccagaagaagctcacagtattataaaagaatgtagaggatctcct
cttgtagtgtctttaattggtgcacttttgcgtgattttcccaaccgctgggcatattac
ctcaggcaacttcagataaagcaatttaagagaataaggaaatcttcatcttatgattat
gaggctctggatgaagccatgtctataagtgttgacatgctcagagaagacatcaaaggt
tattacacagatctttccatccttaagaaggatgttaaggtgcctacaaaggtgttatgt
attctctgggacatggaaaatgaagaagtggaagacatactacaggagtttgttaataag
tctctcttattctgtgatcggaatggaaattcattttgttactatttacatgatcttcaa
atagattttcttacagagaagaattgcaaccagcttcaggacctgcataagaagctgatt
actcagttccagagacatcaccagctacatactctttcaccagatcaggaggactgcatg
tattggtataattttctggcctatcacatggccagtgccaaaatgcacaaagaactttgt
gctctgatgctttccctggattggattaaagcaaaaacagaactcgtaggccctgctcat
ctgattcatgaatttgtggaatataggcatatattggatgaaaaggagtgtgcagtgtgt
gagaatttccaagagtttttatctttaaatggacatcttcttggacgacagccatttcct
aatattgtacaactgggtctctgtgaaccggcaacttcagaagtttatcagcaagccaag
ctgagggccaagcaggaggtcgataacggaatgctttacctggagtggataaacaaagaa
aacatcaagaacctttcccgcttagttgttcgcccccatacagatgctgtttaccatgct
tgcttttctaaggatggtcaaagaatagcgtcttgtggagctgataaaaccttacaggtg
ttcaaagctgaaacaggagagaaacttctagaaatccatgctcatgaggatgaagtgctt
tgctgtgcattctcttcagatgacagatttatagcaacctgctcagtggataaaaaagtg
aagatttggaattatatgactggggaactagtacatacctatgatgagcattcagaacaa
gtcaactgctgccacttcacaaacaacagtcatcaccttcttttagccactgggtcaaat
gaccacttaatcaaactctgggatttgaatcaaaaacattgtcgaaataccttgtttggc
catacaaattcagtcattcactgcagattttcaccagatgataagcttctggctagttgt
tcagctgatggaacattaaagctttgggatgtgaaatcagcaaatgacaggaagagcatt
aatatgaagcagttcttcctaaattcagaggagcctcaagaggatatggaagtgatagtg
aaatgttgttcatggtcttctgatggtgcttcaataatggtggcagcaaaaagtaaaatc
tttctttttgacattcatacgactggccttttggcagagatccatataggccattacagc
accatccagtactgtgacttctcccccagtagccgtttggcagtggtggctttatcccag
tactgtgtggagttgtggaatatggactcacgtttaaaagtagctgattgcagaggacat
ttaagttgggttcattgtgtgatgttttctcctgatggatcatcatttttgacatcttct
gatgaccagacaatcaggctctgggagacaaagaaagtatgtgagaactctgctgtagtg
ttgaagcaagaaatagatgctgtgtttcaagaaaatgaagtgatggttcttggagttgac
aatataagacgtctgcaactcatcaatgggaaaacaggtcagattgattatctgactgaa
gctcaagttagctgctgttgcttaagtccacatcttcagtacattgcatttggaggggaa
gatggagccattgagattttagagctcctaaacaacagaatcttccaatccaggagtggg
cacaagaaaactgtacaacacatgcagttcacagcggatgagaagactcttatttcaagc
tctgatgattcttcaattcaggtatggaattggcagtcaggggaatatgtttttctggaa
gcccatcaggaaacagtgaaagatttcaggctcttgaaaaattcaagactgctttcctgg
tcatttgatggaacagtgaaggtttggaatattattactggaagaatagaaaaagacttt
gtctgtcaccaggatacagtactctcttgtgctgtttcttctgatgctaccaagttttcg
tctacctctactgacaagactgcaaaggtttggagttttgaactcccttcccctcttcat
gaattgaagggccacaaaggctgtgtgcgctgctctgtcttctctgtggacagcaccctg
ttggcaactggagatgacaatggagaaatcaggatatggagcgtctcagatggtgagctc
cttcatttgtgtgctccgatctcagtagaaggaggagctgctacccatggaggctgggtg
acagacctttgtttttctccagatagcaaaatgcttgtctctgctggaggctatcttaag
tggtggaatgttgtcactggggagtcctcacagaccttctacacaaatggaaccaatctt
aagaaaatacatgtgtcctctgacttcaaaacatatgtgactgttgataatcttggtatt
ttatatattttacagattttagagtaa

DBGET integrated database retrieval system