KEGG   Manis javanica (Malayan pangolin): 108407248
Entry
108407248         CDS       T06054                                 

Gene name
PLCG1
Definition
(RefSeq) 1-phosphatidylinositol 4,5-bisphosphate phosphodiesterase gamma-1 isoform X1
  KO
K01116  phosphatidylinositol phospholipase C, gamma-1 [EC:3.1.4.11]
Organism
mjv  Manis javanica (Malayan pangolin)
Pathway
mjv00562  Inositol phosphate metabolism
mjv01100  Metabolic pathways
mjv01521  EGFR tyrosine kinase inhibitor resistance
mjv04012  ErbB signaling pathway
mjv04014  Ras signaling pathway
mjv04015  Rap1 signaling pathway
mjv04020  Calcium signaling pathway
mjv04062  Chemokine signaling pathway
mjv04064  NF-kappa B signaling pathway
mjv04066  HIF-1 signaling pathway
mjv04070  Phosphatidylinositol signaling system
mjv04072  Phospholipase D signaling pathway
mjv04360  Axon guidance
mjv04370  VEGF signaling pathway
mjv04613  Neutrophil extracellular trap formation
mjv04650  Natural killer cell mediated cytotoxicity
mjv04658  Th1 and Th2 cell differentiation
mjv04659  Th17 cell differentiation
mjv04660  T cell receptor signaling pathway
mjv04664  Fc epsilon RI signaling pathway
mjv04666  Fc gamma R-mediated phagocytosis
mjv04670  Leukocyte transendothelial migration
mjv04722  Neurotrophin signaling pathway
mjv04750  Inflammatory mediator regulation of TRP channels
mjv04919  Thyroid hormone signaling pathway
mjv04933  AGE-RAGE signaling pathway in diabetic complications
mjv04935  Growth hormone synthesis, secretion and action
mjv05012  Parkinson disease
mjv05022  Pathways of neurodegeneration - multiple diseases
mjv05135  Yersinia infection
mjv05167  Kaposi sarcoma-associated herpesvirus infection
mjv05170  Human immunodeficiency virus 1 infection
mjv05171  Coronavirus disease - COVID-19
mjv05200  Pathways in cancer
mjv05205  Proteoglycans in cancer
mjv05206  MicroRNAs in cancer
mjv05214  Glioma
mjv05223  Non-small cell lung cancer
mjv05225  Hepatocellular carcinoma
mjv05231  Choline metabolism in cancer
mjv05235  PD-L1 expression and PD-1 checkpoint pathway in cancer
Module
mjv_M00130  Inositol phosphate metabolism, PI=> PIP2 => Ins(1,4,5)P3 => Ins(1,3,4,5)P4
Brite
KEGG Orthology (KO) [BR:mjv00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00562 Inositol phosphate metabolism
    108407248 (PLCG1)
 09130 Environmental Information Processing
  09132 Signal transduction
   04012 ErbB signaling pathway
    108407248 (PLCG1)
   04014 Ras signaling pathway
    108407248 (PLCG1)
   04015 Rap1 signaling pathway
    108407248 (PLCG1)
   04370 VEGF signaling pathway
    108407248 (PLCG1)
   04064 NF-kappa B signaling pathway
    108407248 (PLCG1)
   04066 HIF-1 signaling pathway
    108407248 (PLCG1)
   04020 Calcium signaling pathway
    108407248 (PLCG1)
   04070 Phosphatidylinositol signaling system
    108407248 (PLCG1)
   04072 Phospholipase D signaling pathway
    108407248 (PLCG1)
 09150 Organismal Systems
  09151 Immune system
   04613 Neutrophil extracellular trap formation
    108407248 (PLCG1)
   04650 Natural killer cell mediated cytotoxicity
    108407248 (PLCG1)
   04660 T cell receptor signaling pathway
    108407248 (PLCG1)
   04658 Th1 and Th2 cell differentiation
    108407248 (PLCG1)
   04659 Th17 cell differentiation
    108407248 (PLCG1)
   04664 Fc epsilon RI signaling pathway
    108407248 (PLCG1)
   04666 Fc gamma R-mediated phagocytosis
    108407248 (PLCG1)
   04670 Leukocyte transendothelial migration
    108407248 (PLCG1)
   04062 Chemokine signaling pathway
    108407248 (PLCG1)
  09152 Endocrine system
   04935 Growth hormone synthesis, secretion and action
    108407248 (PLCG1)
   04919 Thyroid hormone signaling pathway
    108407248 (PLCG1)
  09156 Nervous system
   04722 Neurotrophin signaling pathway
    108407248 (PLCG1)
  09157 Sensory system
   04750 Inflammatory mediator regulation of TRP channels
    108407248 (PLCG1)
  09158 Development and regeneration
   04360 Axon guidance
    108407248 (PLCG1)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    108407248 (PLCG1)
   05206 MicroRNAs in cancer
    108407248 (PLCG1)
   05205 Proteoglycans in cancer
    108407248 (PLCG1)
   05231 Choline metabolism in cancer
    108407248 (PLCG1)
   05235 PD-L1 expression and PD-1 checkpoint pathway in cancer
    108407248 (PLCG1)
  09162 Cancer: specific types
   05225 Hepatocellular carcinoma
    108407248 (PLCG1)
   05214 Glioma
    108407248 (PLCG1)
   05223 Non-small cell lung cancer
    108407248 (PLCG1)
  09164 Neurodegenerative disease
   05012 Parkinson disease
    108407248 (PLCG1)
   05022 Pathways of neurodegeneration - multiple diseases
    108407248 (PLCG1)
  09167 Endocrine and metabolic disease
   04933 AGE-RAGE signaling pathway in diabetic complications
    108407248 (PLCG1)
  09171 Infectious disease: bacterial
   05135 Yersinia infection
    108407248 (PLCG1)
  09172 Infectious disease: viral
   05170 Human immunodeficiency virus 1 infection
    108407248 (PLCG1)
   05171 Coronavirus disease - COVID-19
    108407248 (PLCG1)
   05167 Kaposi sarcoma-associated herpesvirus infection
    108407248 (PLCG1)
  09176 Drug resistance: antineoplastic
   01521 EGFR tyrosine kinase inhibitor resistance
    108407248 (PLCG1)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:mjv04131]
    108407248 (PLCG1)
Enzymes [BR:mjv01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.4  Phosphoric-diester hydrolases
    3.1.4.11  phosphoinositide phospholipase C
     108407248 (PLCG1)
Membrane trafficking [BR:mjv04131]
 Exocytosis
  Calcium ion-dependent exocytosis
   Phospholipases
    108407248 (PLCG1)
 Endocytosis
  Macropinocytosis
   Phospholipase C
    108407248 (PLCG1)
SSDB
Motif
Pfam: PI-PLC-X SH2 PI-PLC-Y C2 SH3_1 PH SH3_9 SH3_2 PH_12 GDPD PH_9
Other DBs
NCBI-GeneID: 108407248
NCBI-ProteinID: XP_017531906
LinkDB
Position
Unknown
AA seq 1329 aa
MAGAASPCANGCGPGAPSDAEVLHLCRSLEVGTVMTLFYSKKSQRPERKTFQVKLETRQI
TWSRGADKIEGAIDIREIKEIRPGKTSRDFDRYQEDPAFRPDQSHCFVILYGMEFRLKTL
SLQATSEEEVNMWIKGLTWLMEDTSQAATPLQIERWLRKQFYSVDRNREDRISAKDLKNM
LSQVNYRVPNMRFLRERLTDLEQRSSDITYGQFAQLYRSLMYSAQKTMDLPFMEASALRA
GERPELCRVSLPEFQQFLLEYQGELWAVDRLQVQEFMFSFLRDPLREIEEPHFFLDEFVT
FLFSKENSVWNSQLDAVCPDTMNNPLSHYWISSSHNTYLTGDQFSSESSLEAYARCLRMG
CRCIELDCWDGPDGMPVIYHGHTLTTKIKFSDVLHTIKEHAFVASEYPVILSIEDHCSIA
QQRNMAQYFKKVLGDTLLTKPVDIAADGLPSPNQLKRKILIKHKKLAEGSAYEEVPASVM
YSENDISNSIKNGILYLEDPVNHEWYPHYFVLTSSKIYYSEETSSDQGNEDEEEPKEVSG
SAELHSNEKWFHGKLGAGRDGRHIAERLLTEYCVETGAPDGSFLVRESETFVGDYTLSFW
RNGKVQHCRIHSRQDAGTPKFFLTDNLVFDSLYDLITHYQQVPLRCNEFEMRLSEPVPQT
NAHESKEWYHASLTRAQAEHMLMRVPRDGAFLVRKRNEPNSYAISFRAEGKIKHCRVQQE
GQTVMLGNSEFDSLVDLISYYEKHPLYRKMKLRYPINEEALEKIGTAEPDYGALYEGRNP
GFYVEANPMPTFKCAVKALFDYKAQREDELTFTKSAIIQNVEKQEGGWWRGDYGGKKQLW
FPSNYVEEMVSPAALEPEREHLDENSPLGDLLRGVLDVPACQIAIRPEGKNSRLFVFSIS
MASVAHWSLDVAADSQEELQDWVKKIREVAQTADARLTEGKMMERRKKIALELSELVVYC
RPVPFDEEKIGTERACYRDMSSFPETKAEKYVNKAKGKKFLQYNRLQLSRIYPKGQRLDS
SNYDPLPMWICGSQLVALNFQTPDKPMQMNQALFMAGGHCGYVLQPSTMRDEAFDPFDKS
SLRGLEPCAICVEVLGARHLPKNGRGIVCPFVELEVAGAEYDSAKQKTEFVVDNGLNPVW
PAKSFHFQISNPEFAFLRFVVYEEDMFSDQNFLAQATFPVKGLKTGYRAVPLKNNYSEDL
ELASLLVKIDIFPAKQENGDLSPFGGASLRERGLDASGQLFHGRAREGSFEARYQQPFED
FRISQEHLADHFDSRERSGVITKTLAPHSWRDTSAQSLGRGAAGVIGHVGCSALSGTGWG
WEEKQSLFW
NT seq 3990 nt   +upstreamnt  +downstreamnt
atggcgggcgccgcgtccccctgcgccaatggctgcgggcccggcgcgccctccgacgcc
gaggtgctgcacctctgccgcagcctcgaggtgggcaccgtcatgactttgttctactcc
aagaaatcgcagcggcccgagcggaagaccttccaggtcaagctggagacgcggcagatc
acgtggagccgtggcgccgacaagatcgagggggccattgacattcgggaaatcaaggag
atccgcccagggaagacctcacgagattttgatcgctaccaggaggaccctgctttccga
ccggaccaatcacactgctttgttatcctgtatggaatggaattccgcctgaagaccctg
agcctgcaagctacatctgaggaggaagtgaacatgtggatcaagggcttaacttggctg
atggaggatacatcacaggcggccacacccctgcagattgagaggtggctgcggaagcag
ttctactcagtggatcggaaccgtgaggatcgtatatcagccaaggacctgaagaacatg
ctgtcccaggtcaactatcgggtccccaacatgcgcttcctccgagagcggctgacagac
ctggagcagcgcagcagtgacatcacctatgggcagtttgctcagctgtaccgcagcctc
atgtacagcgcccagaagacgatggacctccccttcatggaagccagtgcgctgagggca
ggggagcggccggagctttgccgagtgtcccttcctgagttccagcagttcctccttgag
taccagggggagctatgggctgttgaccggctccaggtgcaggagttcatgttcagcttc
ctccgggacccactgcgagagattgaggagccgcacttcttcctggacgagtttgtcacc
ttcctgttctccaaagagaacagcgtatggaactcgcagctagatgcagtgtgcccagat
accatgaacaaccctctctcccactactggatttcctcctcgcacaatacgtacctgacc
ggggaccagttctccagcgagtcctccctggaagcctatgctcgctgcctgcggatgggc
tgtcgctgcattgagttggattgttgggacggccctgatgggatgccagtcatttaccac
gggcacacccttaccaccaagatcaagttctcagacgtcctgcacaccatcaaggagcat
gcctttgtggcctcggagtacccagttatcctgtctatcgaggaccactgcagcatcgcc
cagcagaggaacatggcccagtacttcaagaaggtactcggggacacactgctcaccaag
cctgtggacattgctgccgatgggctcccctcacccaaccagctcaagaggaagatcctt
atcaagcacaagaagctggctgagggcagtgcctatgaggaggtgcctgcatccgtgatg
tactctgagaacgacatcagcaactccatcaagaatggcatcctctacctggaggacccc
gtgaaccatgagtggtatccccactacttcgtcctgaccagcagcaagatctactactct
gaggaaaccagcagtgaccagggcaacgaggatgaagaggaacccaaggaggtcagcggc
agcgcagagctgcactccaatgagaagtggttccacgggaagcttggggccggacgggat
gggcgtcacattgctgagcgcctgctcactgagtactgcgttgagactggggcccccgac
ggctccttcctggtgcgcgagagcgagaccttcgtgggcgactacaccctctctttctgg
cggaacggcaaagtccagcactgccgcatccactctcggcaagacgccgggacccccaag
ttcttcctgacagacaacctggtctttgactcactctatgaccttatcacacactaccag
caagttcccctgcgctgcaacgaatttgagatgcgcctctcggagcctgtcccacagacc
aatgcccacgagagcaaagagtggtaccacgccagcctaacccgagcgcaagccgagcat
atgctgatgcgtgttccccgggatggggccttcctggtgcgaaaacgcaatgagcccaac
tcctacgccatctccttccgggctgagggcaagatcaagcattgccgtgtccagcaggag
ggccagacagtaatgctgggcaactcggagtttgacagcctggttgacctcatcagctat
tacgagaagcatccgctgtaccgtaaaatgaagctgcgctatcccatcaacgaggaggcg
ctggagaagatcggcactgctgagcctgactacggagccctgtatgagggacgcaaccct
ggattctacgtggaggcaaaccctatgccgactttcaagtgtgcggtcaaagccctcttt
gactacaaggcccagagagaggatgagctgactttcaccaagagtgccattatccagaat
gtggagaagcaggagggaggctggtggcggggggactatggcggaaagaaacagctatgg
ttcccatctaactacgtggaagagatggtcagccctgcagccctggagcctgagagggag
cacttggacgagaacagccccctaggggacttgctgaggggggtcttggatgtgccagct
tgtcagattgccatccgccctgagggcaagaacagccggctcttcgtcttctccatcagc
atggcgtcggtggcgcactggtccctggatgttgctgctgactcacaggaggagctgcag
gactgggtgaaaaagatccgtgaagtggcgcagactgcagatgccaggctcactgagggg
aagatgatggaacggaggaagaagatcgccctggagctctcggagcttgtcgtctactgc
cggcctgtgccctttgacgaagagaagattggcacagagcgtgcctgctaccgggacatg
tcatcgttcccggaaaccaaggctgagaaatatgtgaacaaggccaaaggcaagaaattc
ctccagtacaaccggctgcagctgtcccgcatctaccccaagggccagcgtctggactcc
tccaattacgaccccttgcccatgtggatctgcggcagtcagctggtggccctcaacttc
cagactccagataagcccatgcagatgaaccaggccctcttcatggctggcgggcactgt
ggctacgtgttgcagccgagcaccatgcgggacgaggccttcgacccatttgacaagagc
agcctccgcgggctggagccatgtgctatctgcgtcgaggtgctgggggcccggcatctg
ccaaagaatggccggggcattgtgtgtcctttcgtggagcttgaggtggctggagcagag
tatgacagtgccaagcagaagacagagtttgtggtggacaatggactgaaccccgtgtgg
ccggccaagtccttccacttccagatcagtaacccggaattcgccttcctgcgctttgtg
gtatatgaggaagacatgtttagtgaccagaacttcctggctcaggctactttcccagtg
aaaggcctgaagacaggatacagagctgtgcctttgaagaacaactacagtgaggacctg
gagctggcctccctgctcgtcaagatagacattttccctgccaagcaggagaacggcgac
ctcagccccttcggtggtgcgtccctgcgggagcgtggcctagatgcttcgggccagctg
tttcacggccgggcccgggaaggctcctttgaagctcgctaccagcagccatttgaggac
ttccgcatctcccaggagcatctggcagaccattttgatagtcgggaacgaagtggtgtc
ataactaagacattggctcctcactcttggagggacacctcagcacagagcctcggacgg
ggagcggcaggtgtcatcggccacgtgggctgttcagcactgtcaggaacggggtgggga
tgggaagagaagcaaagcctattctggtga

DBGET integrated database retrieval system