KEGG   Manis javanica (Malayan pangolin): 108408257
Entry
108408257         CDS       T06054                                 

Gene name
FCER1G
Definition
(RefSeq) high affinity immunoglobulin epsilon receptor subunit gamma isoform X1
  KO
K07983  high affinity immunoglobulin epsilon receptor subunit gamma
Organism
mjv  Manis javanica (Malayan pangolin)
Pathway
mjv04071  Sphingolipid signaling pathway
mjv04072  Phospholipase D signaling pathway
mjv04611  Platelet activation
mjv04625  C-type lectin receptor signaling pathway
mjv04650  Natural killer cell mediated cytotoxicity
mjv04664  Fc epsilon RI signaling pathway
mjv05152  Tuberculosis
mjv05310  Asthma
Brite
KEGG Orthology (KO) [BR:mjv00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04072 Phospholipase D signaling pathway
    108408257 (FCER1G)
   04071 Sphingolipid signaling pathway
    108408257 (FCER1G)
 09150 Organismal Systems
  09151 Immune system
   04611 Platelet activation
    108408257 (FCER1G)
   04625 C-type lectin receptor signaling pathway
    108408257 (FCER1G)
   04650 Natural killer cell mediated cytotoxicity
    108408257 (FCER1G)
   04664 Fc epsilon RI signaling pathway
    108408257 (FCER1G)
 09160 Human Diseases
  09163 Immune disease
   05310 Asthma
    108408257 (FCER1G)
  09171 Infectious disease: bacterial
   05152 Tuberculosis
    108408257 (FCER1G)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:mjv04147]
    108408257 (FCER1G)
Exosome [BR:mjv04147]
 Exosomal proteins
  Exosomal proteins of microglial cells
   108408257 (FCER1G)
SSDB
Motif
Pfam: TCR_zetazeta ITAM
Other DBs
NCBI-GeneID: 108408257
NCBI-ProteinID: XP_017533650
LinkDB
Position
Unknown
AA seq 86 aa
MILAVVLLLLLLAEKAAALGEPQLCYILDAILFLYGIVLTLLYCRLKIQVRKAAIASYEK
SDSVYTGLSTRTQETYETLKHQKPAQ
NT seq 261 nt   +upstreamnt  +downstreamnt
atgattctagcagtggttctgcttttactccttttggctgaaaaagcagctgccctggga
gagcctcagctctgctacatcctggatgccatcctgttcttgtacggcattgtcctcacc
ctgctctactgtcggctcaagatccaggtgcgaaaggcagcgatagccagctatgagaaa
tcagatagtgtttacacgggcctgagcacccggacgcaggagacatatgagaccctgaag
caccagaaaccagcgcagtga

DBGET integrated database retrieval system