KEGG   Manis javanica (Malayan pangolin): 108409113
Entry
108409113         CDS       T06054                                 

Gene name
IL12A
Definition
(RefSeq) interleukin-12 subunit alpha
  KO
K05406  interleukin 12A
Organism
mjv  Manis javanica (Malayan pangolin)
Pathway
mjv04060  Cytokine-cytokine receptor interaction
mjv04620  Toll-like receptor signaling pathway
mjv04622  RIG-I-like receptor signaling pathway
mjv04625  C-type lectin receptor signaling pathway
mjv04630  JAK-STAT signaling pathway
mjv04658  Th1 and Th2 cell differentiation
mjv04940  Type I diabetes mellitus
mjv05133  Pertussis
mjv05134  Legionellosis
mjv05140  Leishmaniasis
mjv05142  Chagas disease
mjv05143  African trypanosomiasis
mjv05144  Malaria
mjv05145  Toxoplasmosis
mjv05146  Amoebiasis
mjv05152  Tuberculosis
mjv05162  Measles
mjv05164  Influenza A
mjv05168  Herpes simplex virus 1 infection
mjv05171  Coronavirus disease - COVID-19
mjv05200  Pathways in cancer
mjv05321  Inflammatory bowel disease
mjv05330  Allograft rejection
Brite
KEGG Orthology (KO) [BR:mjv00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04630 JAK-STAT signaling pathway
    108409113 (IL12A)
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    108409113 (IL12A)
 09150 Organismal Systems
  09151 Immune system
   04620 Toll-like receptor signaling pathway
    108409113 (IL12A)
   04622 RIG-I-like receptor signaling pathway
    108409113 (IL12A)
   04625 C-type lectin receptor signaling pathway
    108409113 (IL12A)
   04658 Th1 and Th2 cell differentiation
    108409113 (IL12A)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    108409113 (IL12A)
  09163 Immune disease
   05321 Inflammatory bowel disease
    108409113 (IL12A)
   05330 Allograft rejection
    108409113 (IL12A)
  09167 Endocrine and metabolic disease
   04940 Type I diabetes mellitus
    108409113 (IL12A)
  09171 Infectious disease: bacterial
   05133 Pertussis
    108409113 (IL12A)
   05134 Legionellosis
    108409113 (IL12A)
   05152 Tuberculosis
    108409113 (IL12A)
  09172 Infectious disease: viral
   05171 Coronavirus disease - COVID-19
    108409113 (IL12A)
   05164 Influenza A
    108409113 (IL12A)
   05162 Measles
    108409113 (IL12A)
   05168 Herpes simplex virus 1 infection
    108409113 (IL12A)
  09174 Infectious disease: parasitic
   05146 Amoebiasis
    108409113 (IL12A)
   05144 Malaria
    108409113 (IL12A)
   05145 Toxoplasmosis
    108409113 (IL12A)
   05140 Leishmaniasis
    108409113 (IL12A)
   05142 Chagas disease
    108409113 (IL12A)
   05143 African trypanosomiasis
    108409113 (IL12A)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04052 Cytokines and growth factors [BR:mjv04052]
    108409113 (IL12A)
   00536 Glycosaminoglycan binding proteins [BR:mjv00536]
    108409113 (IL12A)
Cytokines and growth factors [BR:mjv04052]
 Cytokines
  Interleukins
   108409113 (IL12A)
Glycosaminoglycan binding proteins [BR:mjv00536]
 Heparan sulfate / Heparin
  Cytokines
   108409113 (IL12A)
SSDB
Motif
Pfam: IL12
Other DBs
NCBI-GeneID: 108409113
NCBI-ProteinID: XP_017535009
LinkDB
Position
Unknown
AA seq 328 aa
MPEFRFPFGAAGGGGAVPERLRPGSRGVNPKAPQTPRADLHVSLEADVERDREKESKRPK
SRESPVALRGNYKNVTPWAGIPATALPCRARPSASSRRLRAQRPLSMGPARRLLLVAMLA
LLNHLGHPGLARSLPTATPGLGMLQCLSHSQNLLRAVGNMLQKARQTLEFYSCSSEEIDH
EDITKDKTSTVEACLPLELTTNESCLASREISFLTNGSCLASSKASFMMTLCLSSIYEDL
KMYQVEFKAMNAKLLMDPKRQISLDQNMLAAIDELMQALSFNSETVPQKPSLEEPDFYKT
KIKLCILLHAFRIRVVTIDRMMSYLNSS
NT seq 987 nt   +upstreamnt  +downstreamnt
atgccggaatttcgctttccctttggggcagccggaggcggcggggccgtcccggaacgt
ctgcggccaggctcccggggagttaatccgaaagcgccgcaaaccccgcgggccgacctc
cacgtgtcactagaagctgatgtagagagagaccgagagaaagaaagcaagagaccgaag
tcccgggaaagtcctgtcgcgcttcggggcaattataaaaatgtgaccccctgggccggc
atcccagccaccgccctcccctgtcgcgcccgcccgtccgcgtccagccgccggctccgt
gcacagcgcccgctcagcatgggtcccgctcgcaggctcctcctcgtggccatgctggcc
ctcctaaaccacctgggccaccccggtttggccaggagcctccccacagccacaccaggc
ctaggaatgctccagtgcctcagccactcccaaaacctgctgagagccgtcggcaacatg
cttcagaaggccagacaaacccttgaattttactcctgctcttctgaagagattgatcat
gaagatatcacaaaagataaaaccagtacagtggaggcctgcttaccactggaattaacc
acgaatgagagctgcctggcttccagagagatctctttcttaactaatgggagttgtctg
gcctccagtaaggcctcttttatgatgaccctgtgccttagcagtatctatgaagacttg
aagatgtaccaggtggagttcaaggccatgaatgcaaagcttttgatggatcctaagagg
cagatctctctggatcaaaacatgctggcagctattgatgagctgatgcaggccctgagt
ttcaacagtgagactgtgccacaaaaaccctcccttgaagaaccggatttttataaaact
aaaatcaagctctgcatacttcttcatgctttcagaattcgtgtggtgactatcgataga
atgatgagctatctgaattcttcctaa

KEGG   Manis javanica (Malayan pangolin): 108409190
Entry
108409190         CDS       T06054                                 

Gene name
IL12B
Definition
(RefSeq) interleukin-12 subunit beta
  KO
K05425  interleukin 12B
Organism
mjv  Manis javanica (Malayan pangolin)
Pathway
mjv04060  Cytokine-cytokine receptor interaction
mjv04620  Toll-like receptor signaling pathway
mjv04622  RIG-I-like receptor signaling pathway
mjv04625  C-type lectin receptor signaling pathway
mjv04630  JAK-STAT signaling pathway
mjv04658  Th1 and Th2 cell differentiation
mjv04940  Type I diabetes mellitus
mjv05133  Pertussis
mjv05134  Legionellosis
mjv05140  Leishmaniasis
mjv05142  Chagas disease
mjv05143  African trypanosomiasis
mjv05145  Toxoplasmosis
mjv05146  Amoebiasis
mjv05152  Tuberculosis
mjv05162  Measles
mjv05164  Influenza A
mjv05168  Herpes simplex virus 1 infection
mjv05171  Coronavirus disease - COVID-19
mjv05200  Pathways in cancer
mjv05205  Proteoglycans in cancer
mjv05321  Inflammatory bowel disease
mjv05330  Allograft rejection
Brite
KEGG Orthology (KO) [BR:mjv00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04630 JAK-STAT signaling pathway
    108409190 (IL12B)
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    108409190 (IL12B)
 09150 Organismal Systems
  09151 Immune system
   04620 Toll-like receptor signaling pathway
    108409190 (IL12B)
   04622 RIG-I-like receptor signaling pathway
    108409190 (IL12B)
   04625 C-type lectin receptor signaling pathway
    108409190 (IL12B)
   04658 Th1 and Th2 cell differentiation
    108409190 (IL12B)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    108409190 (IL12B)
   05205 Proteoglycans in cancer
    108409190 (IL12B)
  09163 Immune disease
   05321 Inflammatory bowel disease
    108409190 (IL12B)
   05330 Allograft rejection
    108409190 (IL12B)
  09167 Endocrine and metabolic disease
   04940 Type I diabetes mellitus
    108409190 (IL12B)
  09171 Infectious disease: bacterial
   05133 Pertussis
    108409190 (IL12B)
   05134 Legionellosis
    108409190 (IL12B)
   05152 Tuberculosis
    108409190 (IL12B)
  09172 Infectious disease: viral
   05171 Coronavirus disease - COVID-19
    108409190 (IL12B)
   05164 Influenza A
    108409190 (IL12B)
   05162 Measles
    108409190 (IL12B)
   05168 Herpes simplex virus 1 infection
    108409190 (IL12B)
  09174 Infectious disease: parasitic
   05146 Amoebiasis
    108409190 (IL12B)
   05145 Toxoplasmosis
    108409190 (IL12B)
   05140 Leishmaniasis
    108409190 (IL12B)
   05142 Chagas disease
    108409190 (IL12B)
   05143 African trypanosomiasis
    108409190 (IL12B)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04052 Cytokines and growth factors [BR:mjv04052]
    108409190 (IL12B)
   00536 Glycosaminoglycan binding proteins [BR:mjv00536]
    108409190 (IL12B)
Cytokines and growth factors [BR:mjv04052]
 Cytokines
  Interleukins
   108409190 (IL12B)
Glycosaminoglycan binding proteins [BR:mjv00536]
 Heparan sulfate / Heparin
  Cytokines
   108409190 (IL12B)
SSDB
Motif
Pfam: IL12p40_C Ig_5 Ig_4 fn3 Ig_3 Ig_2
Other DBs
NCBI-GeneID: 108409190
NCBI-ProteinID: XP_017535102
LinkDB
Position
Unknown
AA seq 329 aa
MQPPPFAISWFSLVLLASPLGAIWELEKNVYVVEVDWYPDAPGEMVVLTCDTPEEDGITW
TSDQSGDVLGSGKTLTIQVKEFVDAGQYTCHKGGQVLSHSLLLLHKKEDEIWSTDILKDQ
KEPKSKTFLKCEAKNYSGHFICWWLTAISSGLKFSVKSSRGSSDPQGVTCGAVTLSSERV
RVDHREYKKYMVECQESSACPAAEEVLPIEVVVDAVHKLKYENYTSSFFIRDIIKPDPPK
NLQLKPMTNSRHVEVSWEYPDTWSTPHSYFSLTFCIQVQGKNKRIKKDRLFVDQTLAKVM
CHKDANIHVQARDRYYRSSWSEWASVPCS
NT seq 990 nt   +upstreamnt  +downstreamnt
atgcagcctccaccattcgccatctcctggttttccctggttttgctggcatctcccctt
ggggccatatgggaactggagaaaaatgtttatgttgtagaggtggactggtaccccgat
gcccctggagaaatggtggtcctcacctgtgacacccccgaagaagatggcatcacctgg
acctcagaccagagcggtgacgtcttaggctctggcaaaaccttgaccatccaagtcaaa
gagtttgtcgatgccggccagtacacctgtcacaaaggaggccaggttttgagccattca
ctcctgctgcttcacaaaaaggaagatgaaatttggtccactgatatcttaaaggaccag
aaagaacccaaaagcaagacctttttgaaatgtgaggcaaagaactattccggacatttc
atctgctggtggctgacagccatcagcagtggtttgaaattcagtgtcaaaagcagcaga
ggctcctctgacccccaaggggtgacatgtggagcagtgacactctcatcggagagagtc
cgagtggaccacagggagtataagaagtacatggtggagtgtcaggagagcagtgcctgt
ccagctgccgaggaggttctgcccattgaagttgtggtggacgctgttcacaagctcaag
tatgaaaactacaccagcagcttcttcatcagggatatcatcaaaccagacccacccaag
aacctgcagctgaagccaatgacaaattctcggcacgtggaggtcagctgggagtaccct
gacacctggagcaccccacattcctacttctccctgacattttgcattcaggtccagggc
aagaacaagagaataaagaaagatagactcttcgtggaccagaccttagccaaggtcatg
tgccacaaggatgccaatatccacgtgcaagcccgtgaccgctactacaggtcatcctgg
agcgaatgggcatctgtgccctgcagttag

DBGET integrated database retrieval system