KEGG   Manis javanica (Malayan pangolin): 108409115
Entry
108409115         CDS       T06054                                 

Gene name
MAPK7
Definition
(RefSeq) mitogen-activated protein kinase 7
  KO
K04464  mitogen-activated protein kinase 7 [EC:2.7.11.24]
Organism
mjv  Manis javanica (Malayan pangolin)
Pathway
mjv04010  MAPK signaling pathway
mjv04540  Gap junction
mjv04657  IL-17 signaling pathway
mjv04722  Neurotrophin signaling pathway
mjv04912  GnRH signaling pathway
mjv04921  Oxytocin signaling pathway
mjv05206  MicroRNAs in cancer
mjv05418  Fluid shear stress and atherosclerosis
Brite
KEGG Orthology (KO) [BR:mjv00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    108409115 (MAPK7)
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04540 Gap junction
    108409115 (MAPK7)
 09150 Organismal Systems
  09151 Immune system
   04657 IL-17 signaling pathway
    108409115 (MAPK7)
  09152 Endocrine system
   04912 GnRH signaling pathway
    108409115 (MAPK7)
   04921 Oxytocin signaling pathway
    108409115 (MAPK7)
  09156 Nervous system
   04722 Neurotrophin signaling pathway
    108409115 (MAPK7)
 09160 Human Diseases
  09161 Cancer: overview
   05206 MicroRNAs in cancer
    108409115 (MAPK7)
  09166 Cardiovascular disease
   05418 Fluid shear stress and atherosclerosis
    108409115 (MAPK7)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:mjv01001]
    108409115 (MAPK7)
Enzymes [BR:mjv01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.24  mitogen-activated protein kinase
     108409115 (MAPK7)
Protein kinases [BR:mjv01001]
 Serine/threonine kinases: CMGC group
  MAPK family [OT]
   108409115 (MAPK7)
SSDB
Motif
Pfam: Pkinase PK_Tyr_Ser-Thr Kdo Kinase-like APH Rrn6
Other DBs
NCBI-GeneID: 108409115
NCBI-ProteinID: XP_017535008
LinkDB
Position
Unknown
AA seq 796 aa
MAEPLKEEDGEDGSGEPPGPAKAEPAHTAASVAAKNLALLKARSFDVTFDVGDEYEIIET
IGNGAYGVVSSARRRLTGQQVAIKKIPNAFDVVTNAKRTLRELKILKHFKHDNIIAIKDI
LRPTVPYGEFKSVYVVLDLMESDLHQIIHSSQPLTLEHVRYFLYQLLRGLKYMHSAQVIH
RDLKPSNLLVNENCELKIGDFGMARGLCTSPAEHQYFMTEYVATRWYRAPELMLSLHEYT
QAIDLWSVGCIFGEMLARRQLFPGKNYVHQLQLIMMVLGTPSPAVIQAVGAERVRAYIQS
LPPRQPVPWETVYPGADRQALSLLGRMLRFEPSARISAAAALRHPFLAKYHDPDDEPDCA
PPFDFAFDREALTRERIKEAIVAEIEDFHARREGIRQQIRFQPSLQPVASEPGCPDVEMP
SHWAPSGDCVMESPPPAPPPCPGPSPDTIDLTLQPPPPTGEPAPPKREGAISDNTKAALK
AALLKSLRSRFRDGPSAPLEAPEPRKPVTAQERQREREEKRRRRQERAKERERRRQERGR
KERGAGASGGPSTDPLAGLVLSDNDRSLLERWTRMARPPAPAPVAPPPTKPTSPPTAPPQ
PAGSTPGAAPQSACPPLGPAPHPASPPGPGPGPAPLPTATSSLLAPQPLVPASGLPGPSA
AGVLPYFSSGPFPPDPGGASQPSTSESPDVNLVTQQLSKSQVEDPLPPVFSGTPKGSGAG
YGVGFDLEEFLNQSFDMGVADGTQDGQADSASLSASLLADWLEGHGMNPADIESLQREIQ
MDSPMLLADLPDLQDP
NT seq 2391 nt   +upstreamnt  +downstreamnt
atggccgagcccctgaaggaagaagatggcgaggacggctctggggagccccccgggccg
gcgaaggcggagcccgcccacacagccgcctctgtagcggcgaagaacctggccttgctc
aaagcccgctccttcgatgtgaccttcgacgtgggggacgagtacgagatcatcgagacc
ataggcaatggggcctacggggtggtgtcgtctgcgcgccgccgcctcaccggccagcag
gtggccattaagaagatccctaatgcttttgatgtggtgaccaatgccaagcggactctc
agggagctgaagatcctcaaacacttcaagcatgacaacatcattgccatcaaggacatc
ctgagacctacagtgccctatggcgagttcaaatctgtctatgttgttctcgacctgatg
gagagtgacctgcaccagatcattcactcctcgcagccactcacactggagcacgtgcgc
tatttcctgtaccagctgctgcggggtctgaaatacatgcactcagctcaggtcatccat
cgagacctcaagccctccaatctgttggtgaatgagaactgcgagctcaagatcggtgac
tttggcatggcccggggcctgtgcacctcacctgctgagcaccaatacttcatgactgag
tatgtggccacacgctggtatcgcgcccccgagctcatgctctcacttcatgagtacaca
caggctattgacctgtggtctgtaggctgcatctttggtgagatgctggcccggcgccag
ctcttcccaggcaaaaattatgtgcaccagctgcagctgatcatgatggtgctgggcact
ccatcgccagctgtgattcaggctgtgggggctgagagggtgcgggcgtacatccagagc
ctgcctccgcgccaacctgtgccctgggagacagtgtatccaggtgctgaccgccaggcc
ctctcactgctgggacgcatgctgcgttttgagcccagtgcccgcatctcagcagctgct
gcccttcggcaccctttcctggccaagtaccatgatcctgacgatgagcctgactgtgcc
ccaccctttgacttcgcctttgaccgtgaagccctcactcgggagcgcattaaggaggcc
attgtggctgagattgaggacttccatgcgcggcgtgagggcatccgccagcagatccgc
ttccagccttcccttcagcctgtggccagtgagcctggctgccccgatgtggagatgccc
agtcactgggctcccagtggagactgtgtcatggaatcacccccgccagcccctccgcca
tgccctggcccttcacctgacaccattgatctgaccctgcagccacccccgccaaccggt
gaaccagctcctccaaagagggagggtgccatctccgacaacaccaaagctgccctcaaa
gctgccctactcaagtccctgcggagccggttcagagatggccctagtgcccccctggaa
gcccctgagcctcgaaagccagtgacagcccaggaacgccagcgagagcgggaggagaag
cggcggcggcggcaggagcgcgccaaggagcgggagaggcggcggcaggagcgaggccgc
aaggagcggggggccggggcctctgggggcccctccactgatcccttggctgggctggtg
ctcagtgacaatgaccgcagcctgttggagcgttggactcgcatggctcggcccccagcc
ccagcccctgtggcaccccctccaaccaagcccaccagccctcccactgccccaccacag
cctgcagggtctacccctggtgctgccccacagtctgcctgcccacccctgggccctgct
ccccacccagccagcccaccagggcctggccctggccctgctccactcccgactgccacc
tccagcctcctggccccccagccgcttgtgccagcctctgggttgcctggccccagtgcc
gcgggtgttttgccttacttctcgtctggcccattccctccagaccctgggggtgcctct
cagccctccacctccgagtcacctgatgtcaacctggtgacccagcagctgtccaagtcg
caggtggaggaccccttgccccccgtgttctcaggcactccaaagggcagtggggctggc
tatggtgttggctttgacctggaggaattcctaaaccagtcttttgacatgggtgtggct
gatgggacacaggatggccaggcagactcggcctcactctcagcctccttgcttgctgac
tggcttgagggccacggcatgaacccagctgacattgagtccctgcagcgtgagatccag
atggactccccaatgctgctggctgacctgcctgacctccaggacccctga

DBGET integrated database retrieval system