KEGG   Methanopyrus kandleri: MK0190Help
Entry
MK0190            CDS       T00078                                 

Definition
(GenBank) Uncharacterized protein conserved in archaea
  KO
K01595  phosphoenolpyruvate carboxylase [EC:4.1.1.31]
Organism
mka  Methanopyrus kandleri
Pathway
mka00620  Pyruvate metabolism
mka00680  Methane metabolism
mka00720  Carbon fixation pathways in prokaryotes
mka01100  Metabolic pathways
mka01120  Microbial metabolism in diverse environments
mka01200  Carbon metabolism
Module
mka_M00168  CAM (Crassulacean acid metabolism), dark
Brite
KEGG Orthology (KO) [BR:mka00001]
 Metabolism
  Carbohydrate metabolism
   00620 Pyruvate metabolism
    MK0190
  Energy metabolism
   00720 Carbon fixation pathways in prokaryotes
    MK0190
   00680 Methane metabolism
    MK0190
Enzymes [BR:mka01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.31  phosphoenolpyruvate carboxylase
     MK0190
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PEPcase_2
Motif
Other DBs
NCBI-ProteinID: AAM01407
UniProt: Q8TYV1
LinkDB All DBs
Position
182418..184016
Genome map
AA seq 532 aa AA seqDB search
MEKVREARIARTLATQHPDATKFVRVQEEPEEAVECLVELGAEEYMVDFEGKLTPYLQPI
QVLMELYDAGVRVGEERFVIVRVPSATKENVLRQVQALLGVMEANSELLKEDPDARGIFE
VVHPMTSSPEELVETVDRISYARRFASRELDVPLKAGNLRIIPLIEEVPELLDIRNILTG
YVEGMREIGMDVSYLRVFIGRSDPALSYGHLPAVLACKLAIFEVYELSDELGVPMAPILG
GGCLPFRGHIRPGMEEEFVEEYAGTATYTVQSGFRYDHDREKAVASIRRINELAANDPLQ
LSGDDIEYLVLATAIFMKHYLSVFFRCIGTLNIVADMIPNTRDRLARKGPVGYARDIPEP
DRVGAQCKDLGDVGRELYRELRRMRVEKLPELPRAIKFTGACYTVGMPPELIGTGRGLAE
IEERLGEDALDAVISRLYPMLREDLQFAVEYTFLETAGSVLPSSGVAMVNTDLEYCVEYL
DLEPPSDFEYQNLVHTLEPYLRYVVSEGGVEEVNPFVRDLLLEMGRMRGSLG
NT seq 1599 nt NT seq  +upstreamnt  +downstreamnt
gtggagaaagtccgagaagctcgaattgcacggacgctggccacccagcatcctgacgcg
acgaagttcgtgagggtgcaggaggagcctgaggaggccgtggagtgtctggtcgagctc
ggcgcggaggaatacatggtggatttcgagggcaagctgacgccgtacctgcagcccatt
caggtcctcatggaactgtacgacgccggcgttcgggtgggagaggaacgtttcgtgatc
gtcagggtacctagtgcgacgaaggagaacgtactacgccaagtccaggccctgctgggt
gtaatggaagccaactcggagttgcttaaggaggacccagacgcccgcgggatcttcgag
gtagtacatcccatgacgtcctcgcccgaagagctcgtggaaacagtggacaggatctca
tacgcgcgcaggttcgcgtcccgtgagctagacgtaccacttaaggcgggaaacctccgg
atcatcccacttatcgaggaagttcccgaactcctagacattcgcaacattctaacgggc
tacgtggaagggatgcgtgaaatcgggatggacgtcagctacctcagggtgttcatcgga
cgctccgaccccgcgctatcctacgggcatcttccggcggtcctcgcctgcaagctggcc
attttcgaagtgtatgagctgtcggacgaactaggtgtcccgatggcgcctatcttagga
ggcgggtgcctgccgttccgcggccatattaggccgggaatggaagaagagttcgtagag
gagtacgcgggcaccgccacgtacaccgtacaatccggattccggtacgatcacgaccgg
gaaaaggccgttgcgtccatccgccgcattaacgagctcgccgcgaacgacccactccaa
ctttccggggacgacatcgagtacctcgtcttagccaccgcgatcttcatgaagcactac
ctcagcgtgttcttccgttgcataggtacgctgaacatcgtcgccgacatgatccccaat
acaagggaccgattggcacgtaaggggcccgtagggtacgcgcgggacattcccgaacct
gaccgtgtcggagcacagtgtaaggaccttggagatgtgggtcgtgagttataccgcgaa
ctgcgccgaatgagggtcgagaagctgcccgagctgccacgcgcgatcaaattcacggga
gcctgctacaccgtcgggatgccaccggagctcatcggaaccggaaggggactcgcggag
atcgaggagcggctaggtgaagatgcgttggacgctgtgatctcacgattgtaccccatg
ctacgcgaggatctgcagttcgcagtggagtacaccttcctcgaaacggccggatccgtc
ctaccgtcgtccggagtagcgatggtcaacaccgacctggagtactgcgtcgagtacctc
gacctggaacccccatccgacttcgagtaccagaacctggtacacacgttggaaccgtac
ctcaggtacgtggtctcggagggtggtgtagaggaagtcaacccgttcgtgagggatctc
ctcctcgagatgggccgaatgcgtggatcactcggatga

DBGET integrated database retrieval system