KEGG   Methanopyrus kandleri: MK0390Help
Entry
MK0390            CDS       T00078                                 

Definition
(GenBank) Predicted HD-superfamily hydrolase
  KO
K17487  7,8-dihydroneopterin 2',3'-cyclic phosphate phosphodiesterase [EC:3.1.4.56]
Organism
mka  Methanopyrus kandleri
Pathway
mka00790  Folate biosynthesis
mka01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:mka00001]
 09100 Metabolism
  09108 Metabolism of cofactors and vitamins
   00790 Folate biosynthesis
    MK0390
Enzymes [BR:mka01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.4  Phosphoric-diester hydrolases
    3.1.4.56  7,8-dihydroneopterin 2',3'-cyclic phosphate phosphodiesterase
     MK0390
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: HD TraI_2 HD_6 HD_2 HDOD
Motif
Other DBs
NCBI-ProteinID: AAM01605
UniProt: Q8TYB2
LinkDB All DBs
Position
complement(372970..373710)
Genome map
AA seq 246 aa AA seqDB search
MRTEELKLKLKELVESIEDEGLRELVMKVLEEGFAHEEVPDPEPVEEAPASRRQHHSYPG
GLLEHTVATTKLALAMAEVFEEIYGLEVDRDLVIAAAILHDLGKATSYERREERYKISDF
GRRLDHLTLIAAELYARGAPVELIHAVAAHHGRGSPVPPNTPEALIVHLADRSDAEFATE
VIKAARNVVRARLRELDVEPTDELVEEVLRRVGPSEIFLTRVREGRDAVRQLVAETLEEI
EEGSSP
NT seq 741 nt NT seq  +upstreamnt  +downstreamnt
ttgaggaccgaggagttgaaactgaagctgaaggagctcgtcgaaagtatcgaagacgag
ggcctgcgagaactcgttatgaaggttttggaagaggggttcgcccacgaagaagtaccc
gatcccgagcccgtcgaggaggctccggctagccgcagacaacatcattcttacccaggg
ggattgctcgaacacacagtggcaacaaccaaactcgccctcgcgatggccgaggtattc
gaggaaatctacgggttggaggtggaccgtgacctcgtgatcgcggccgcgatactccac
gacttgggtaaggcgacgtcctacgagcggcgcgaggagcggtacaagatctccgacttc
ggacgtcgattggaccacctcacactgatcgcggcggagctgtacgctcgaggtgcgccg
gtggaactcatccacgcggtggccgcacatcacggtcgcggatctccggtacctccgaac
acaccggaagccctcatcgtgcaccttgcagatcggtccgacgccgagttcgccaccgaa
gtgatcaaggcagcccgtaacgtggtcagggctcggcttagggagctcgacgtggagcct
accgacgagctagtcgaagaggtcctaagacgcgtcgggccctccgagatcttcctcacc
agggttcgagaggggcgagacgccgtcagacagctggtggccgagaccctcgaggagatc
gaggaaggctcgtccccatag

DBGET integrated database retrieval system