KEGG   Mycobacterium kansasii 824: LH54_17285Help
Entry
LH54_17285        CDS       T03653                                 

Definition
(GenBank) aminotransferase
  KO
K14260  alanine-synthesizing transaminase [EC:2.6.1.66 2.6.1.2]
Organism
mki  Mycobacterium kansasii 824
Pathway
mki00220  Arginine biosynthesis
mki00250  Alanine, aspartate and glutamate metabolism
mki00290  Valine, leucine and isoleucine biosynthesis
mki01100  Metabolic pathways
mki01110  Biosynthesis of secondary metabolites
mki01130  Biosynthesis of antibiotics
mki01210  2-Oxocarboxylic acid metabolism
mki01230  Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:mki00001]
 Metabolism
  Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    LH54_17285
   00290 Valine, leucine and isoleucine biosynthesis
    LH54_17285
   00220 Arginine biosynthesis
    LH54_17285
Enzymes [BR:mki01000]
 2. Transferases
  2.6  Transferring nitrogenous groups
   2.6.1  Transaminases
    2.6.1.2  alanine transaminase
     LH54_17285
    2.6.1.66  valine---pyruvate transaminase
     LH54_17285
Amino acid related enzymes [BR:mki01007]
 Aminotransferase (transaminase)
  Class I
   LH54_17285
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Aminotran_1_2 DegT_DnrJ_EryC1 Aminotran_5 Cys_Met_Meta_PP Beta_elim_lyase Aminotran_3
Motif
Other DBs
NCBI-ProteinID: AIR29196
LinkDB All DBs
Position
complement(3769744..3771033)
Genome map
AA seq 429 aa AA seqDB search
MDSDETMVDVTTHQLPWHASAHHRQRTFAQSSKLQDVLYEIRGPVHQHAARLEAEGHRIL
KLNIGNPAPFGFEAPDVIMRDMIQALPYAQGYSDSQGILSARRAVVTRYELVEGFPRFDV
DDVYLGNGVSELITMTLQALLDNGDQVLIPSPDYPLWTASTSLAGGTPVHYLCDETQSWQ
PDIADLESKITDRTKALVVINPNNPTGAVYSREILTQMVDLARKHQLLLLADEIYDKILY
DDAKHISVASLAHDMLCLTFNGLSKAYRVAGYRAGWLAITGPKDHASSFIEGISLLANMR
LCPNVPAQHGIQVALGGHQSIEDLVLPGGRLLEQRDVAWTKLNEIPGVSCVKPAGALYAF
PRLDPEVYDIADDEELVLDLLLSEKILVTQGTGFNWPAPDHLRLVTLPWSRDLAAAIERL
GNFLVSYRQ
NT seq 1290 nt NT seq  +upstreamnt  +downstreamnt
ctggacagcgatgagaccatggttgacgtgactactcaccagctgccctggcacgcctcc
gcacatcatcggcagcgcaccttcgcgcagtcgtccaagctgcaggacgtcctgtacgaa
atccgcggcccggtacaccaacacgccgcgcggctggaagccgaaggtcaccgcatcctc
aagctcaacatcggcaacccggcgccgttcggtttcgaggcgcccgacgtgatcatgcgt
gacatgatccaagcgctgccctacgcccagggatactccgactctcagggcattttgtcg
gcccgccgtgcggtggtcacccgctacgagctggtcgagggcttcccgcgattcgacgtc
gacgacgtctatttgggcaacggggtgtccgagctgatcaccatgacgttgcaggccctg
ctggacaacggcgatcaggtgttgatcccgtcaccggactacccactgtggacggcgtcg
acctcgctggccggcggcacgcccgtgcactacctctgcgacgagacccagagctggcag
cccgacatcgccgacctggaatccaagatcaccgaccgcaccaaggccctggtcgtgatc
aacccgaacaaccccaccggtgcggtctacagccgcgaaatcctcacccagatggtcgat
ttggcgcgcaagcatcaactgctgctgctcgccgacgagatctacgacaagatcctctac
gacgacgccaaacacatcagcgtggcctcgctcgcccacgacatgttgtgcctgaccttc
aacggtctgtccaaggcataccgggtcgccggataccgggccggctggctggcgatcacc
gggcccaaagaccacgccagcagcttcatcgagggcatcagtctgctggccaacatgcgg
ctgtgcccaaatgtcccggcgcagcacggaattcaggtcgccctcggcggacaccagagc
atcgaggatctagtgcttcccggcggccggctgctcgagcagcgcgacgttgcctggacc
aagctcaatgagattcccggggtctcgtgtgtcaagccggccggcgcgctgtacgcgttt
ccccgattggaccctgaggtctacgacatcgccgacgacgaggaactcgtcctggacctc
ttgctgtccgagaaaattctggtcacccagggcaccggattcaattggccggcacccgat
cacctgcgcctggtgacattgccgtggtctcgtgatcttgccgccgcgatcgagcggctg
ggtaacttcctggtcagctaccgccagtag

DBGET integrated database retrieval system