KEGG   Mycobacterium kansasii 824: LH54_20075Help
Entry
LH54_20075        CDS       T03653                                 

Definition
(GenBank) glutamate decarboxylase
  KO
K01580  glutamate decarboxylase [EC:4.1.1.15]
Organism
mki  Mycobacterium kansasii 824
Pathway
mki00250  Alanine, aspartate and glutamate metabolism
mki00410  beta-Alanine metabolism
mki00430  Taurine and hypotaurine metabolism
mki00650  Butanoate metabolism
mki01100  Metabolic pathways
mki01110  Biosynthesis of secondary metabolites
mki01120  Microbial metabolism in diverse environments
mki02024  Quorum sensing
Module
mki_M00027  GABA (gamma-Aminobutyrate) shunt
Brite
KEGG Orthology (KO) [BR:mki00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00650 Butanoate metabolism
    LH54_20075
  09105 Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    LH54_20075
  09106 Metabolism of other amino acids
   00410 beta-Alanine metabolism
    LH54_20075
   00430 Taurine and hypotaurine metabolism
    LH54_20075
 09140 Cellular Processes
  09145 Cellular community - prokaryotes
   02024 Quorum sensing
    LH54_20075
Enzymes [BR:mki01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.15  glutamate decarboxylase
     LH54_20075
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Pyridoxal_deC Aminotran_5
Motif
Other DBs
NCBI-ProteinID: AIR29698
LinkDB All DBs
Position
4375275..4376657
Genome map
AA seq 460 aa AA seqDB search
MSRSHPSVPAHSIAPAYTGRMFTAPIPALRLPEESMDPEAAYQFIHDELMLDGSSRLNLA
TFVTTWMDPEAGQLMAETFDKNMIDKDEYPATAAIESRCVSMVADLFHAEGLRDDDPGSA
TGVSTIGSSEAVMLGGLAMKWRWRARTKDWKGRTPNLVMGSNVQVVWEKFCRYFDVEPRY
LPMEKGRYVITPEQVIDAVDEDTIGVVAILGTTYTGELEPVAEICAALDGLAARGGVDVP
VHVDAASGGFVVPFLHPDLQWDFRLPRVVSINVSGHKYGLTYPGVGFVVWRGPEYLPEEL
VFRVNYLGGDMPTFTLNFSRPGNQVVGQYYNFLRLGREGYTKVMQALSQTARWLGEQLEG
AEHCELISDGSAIPVVAFRLAGDRGYTEFDLSHELRTCGWQVPAYTMPDNATDISVLRIV
VREGLSADLARALHDDISTAVRTLDKVKPGGHYDAQHFAH
NT seq 1383 nt NT seq  +upstreamnt  +downstreamnt
gtgtcccgcagccacccgtccgtgcccgcgcactcgattgctccggcctacaccgggcgg
atgttcaccgcccctatcccggcgctccggttgcccgaggaatcgatggatccggaagcc
gcctaccagttcatccacgacgagctcatgctcgacggcagttcgcggctgaacctggcc
acctttgtcaccacctggatggaccctgaggctgggcagctgatggccgagacgttcgac
aagaacatgatcgacaaagacgaatacccggcgaccgcggccatcgagtcccgctgtgta
tccatggtggccgaccttttccatgccgaggggctgcgcgacgacgacccgggcagcgcc
accggggtgtcgacgatcggctccagtgaggcggtaatgctgggtgggctggccatgaag
tggcgttggcgggcaaggaccaaggactggaagggtcgcacacccaacctggtgatgggc
tccaacgtgcaggtggtgtgggagaagttctgccggtacttcgacgtcgaaccccgttat
ctgccgatggagaaagggcgctacgtcattactcccgaacaggtcatcgatgccgtcgac
gaggacaccatcggtgtggtggcgattctgggcaccacctacaccggtgagctggagccg
gtcgccgagatctgcgcggcgctggacgggctggcagcccgcggcggggtggacgtcccc
gtgcacgtcgacgccgccagcggcggcttcgtggtgccgttcctgcatccggacctgcag
tgggacttccggctgccccgggtggtgtccatcaacgtcagcggccacaagtacgggctg
acctatcccggcgtcgggttcgtggtgtggcgcggccccgaatatctgcccgaggaactg
gtgttccgggtcaattacctgggcggggacatgccgacgttcacgctgaacttctctcgt
ccgggcaaccaggttgtcggccagtattacaacttcctgcggctgggccgcgagggttac
accaaggtcatgcaggcgctgtcgcagacggcgcggtggctcggcgagcagctggagggc
gccgagcattgcgagttgatctcggacggttcggcgattccggtggtcgccttccggctc
gccggggaccgcggttacaccgagttcgacctctcgcacgagttgcggacgtgcggatgg
caggtgccggcatacaccatgccggacaacgccaccgacatctccgtactgcgcattgtg
gtgcgggaaggactgtccgccgacctggcccgggcattgcatgacgacatctctaccgcg
gtgcgaaccctggacaaggtcaagcccggcgggcattacgacgcccagcacttcgcgcat
tag

DBGET integrated database retrieval system