KEGG   Mycobacterium kansasii 824: LH54_26045Help
Entry
LH54_26045        CDS       T03653                                 

Definition
(GenBank) 4-aminobutyrate aminotransferase
  KO
K07250  4-aminobutyrate aminotransferase / (S)-3-amino-2-methylpropionate transaminase [EC:2.6.1.19 2.6.1.22]
Organism
mki  Mycobacterium kansasii 824
Pathway
mki00250  Alanine, aspartate and glutamate metabolism
mki00280  Valine, leucine and isoleucine degradation
mki00410  beta-Alanine metabolism
mki00640  Propanoate metabolism
mki00650  Butanoate metabolism
mki01100  Metabolic pathways
mki01120  Microbial metabolism in diverse environments
Module
mki_M00027  GABA (gamma-Aminobutyrate) shunt
Brite
KEGG Orthology (KO) [BR:mki00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00640 Propanoate metabolism
    LH54_26045
   00650 Butanoate metabolism
    LH54_26045
  09105 Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    LH54_26045
   00280 Valine, leucine and isoleucine degradation
    LH54_26045
  09106 Metabolism of other amino acids
   00410 beta-Alanine metabolism
    LH54_26045
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01007 Amino acid related enzymes [BR:mki01007]
    LH54_26045
Enzymes [BR:mki01000]
 2. Transferases
  2.6  Transferring nitrogenous groups
   2.6.1  Transaminases
    2.6.1.19  4-aminobutyrate---2-oxoglutarate transaminase
     LH54_26045
    2.6.1.22  (S)-3-amino-2-methylpropionate transaminase
     LH54_26045
Amino acid related enzymes [BR:mki01007]
 Aminotransferase (transaminase)
  Class III
   LH54_26045
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Aminotran_3
Motif
Other DBs
NCBI-ProteinID: AIR30749
LinkDB All DBs
Position
complement(5717664..5719013)
Genome map
AA seq 449 aa AA seqDB search
MASLEQTRHLVTEIPGPASLELNKRRVAAVSSGVGVMLPVFVVRAGGGILEDADGNRLID
LGSGIAVTTIGNSHPKVVDAVREQVAEFTHTCFMVTPYEQYVAVAEQLNRITPGSGEKRS
ALFNSGAEAVENAIKIARAYTRKPAVVAFDHAYHGRTNMTMALTAKSMPYKSGFGPFAPE
IYRAPLSYPYRDGLLDKELATDGELAAARTISVIDKQVGASNLAAVIIEPIQGEGGFIVP
ADGFLPALLDWCRSNDVVFIADEVQTGFARTGAMFACEHEGTDGLEPDLIVTAKGIADGL
PLSAVTGRAEIMDAPHASGVGGTFGGNPVACAAALATIETIEREGLVERARQIEQQIMDR
LLRLQVADDRVGDVRGRGAMIALELVKSGTAEPDAELTEKLATAAHRAGVILLTCGMFGN
VIRLLPPLTITDELLAEGLDIMCGILGDL
NT seq 1350 nt NT seq  +upstreamnt  +downstreamnt
gtggccagcctcgagcagacacgccacctggtcaccgaaatcccgggtcccgcatcgctg
gaactgaacaaacggcgggtcgcggcggtgtccagtggtgtaggggtcatgctgccggtg
ttcgtcgtccgcgccggcggggggatcctcgaggatgccgacgggaaccggctcatcgac
ctgggttccgggatcgccgtgacgaccatcggcaattcccatcccaaggtcgtggacgcg
gtgcgcgagcaggtggcggagttcacccacacctgcttcatggtgacgccctacgagcag
tacgtggccgtcgccgaacaactcaaccggatcaccccgggctccggcgagaagcgctcg
gcgctgttcaactccggcgccgaggccgtcgagaacgccatcaagatcgcccgcgcttac
acccgcaagcccgcggtggtcgcgttcgaccacgcgtatcacggccgcaccaacatgacg
atggcgctgaccgccaagtccatgccctacaagagcggcttcggcccgttcgccccggag
atctaccgggctccgctgtcctacccctaccgcgacggactgctcgacaaggagctggcc
accgacggtgaactggccgccgcacggaccatcagcgtcatcgacaagcaggtcggcgcc
agcaacttggccgccgtcatcatcgagcccatccagggcgaaggcggtttcatcgttccc
gccgacgggttcctgcccgcgctgctggactggtgccgcagcaacgacgtcgtcttcatc
gccgacgaggtgcagaccggctttgcccgcaccggcgcgatgttcgcctgcgagcacgag
ggcaccgacggcctggagcccgacctgatcgtcaccgccaagggcatcgccgacggactg
ccgctgtccgcggtgaccggtcgggccgagatcatggatgcaccgcacgccagcggtgtg
ggcggcacgttcggcggcaacccggtcgcgtgtgcggccgcgctggccaccatcgaaacc
atcgaacgtgagggcctggtggaacgggcccggcagatcgagcagcagatcatggaccgg
ttgttgcggctgcaggtggccgacgaccgagtgggcgacgtgcgtggtcgcggcgccatg
atcgccctcgagctggtgaagtccggaaccgccgaacccgacgccgagctgaccgagaaa
ctggccaccgcagcccaccgcgccggggtgatcctgttgacttgcggcatgttcggcaac
gtcatccggctactgccgccgctgaccatcaccgacgagctactggccgaaggcctcgac
atcatgtgcgggatcctgggcgacctctga

DBGET integrated database retrieval system