KEGG   Mycobacterium sp. KMS: Mkms_0961Help
Entry
Mkms_0961         CDS       T00442                                 

Definition
(GenBank) glycosyl transferase, group 1
Organism
mkm  Mycobacterium sp. KMS
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Glyco_trans_4_4 Glyco_trans_1_4 Glyco_transf_4 Glycos_transf_1 FA_synthesis Epimerase_2
Motif
Other DBs
NCBI-ProteinID: ABL90175
UniProt: A1UBG7
LinkDB All DBs
Position
1047009..1048286
Genome map
AA seq 425 aa AA seqDB search
MRKRPDVLILGLNYPPEPTGIAPYTGALASGLNSLGRHVTAQVAHPHYPEWVVREGYGQW
SRVEQLDGVEVRRLLHYVPKSPRGLRRLLSETSFGLRLLFARWGRPRIVITVSPSLFSAA
LAALRIRLTPRRPPFIVWIQDIYTLGLAETGEGGGFAATLTRWVESRTLRSADRVVVIHH
RFADYVARELGVKASDVVVVRNWAHLAMEMPVSSASAKLALGWPSGVILAVHTGNMGLKQ
GLENIVDAAREADERSAPVHFLLVGDGGERRKLMERAHGISRITFVGPLSDADYRLALSA
ADVLLVNEKPGISSMAVPSKLTSYFHAGRPVIAATDADGITASEVLAAGAGIVVPAGEHS
ALLDAVLDLGDDPAAAARFGRNGRRYRESVLDEQVAIAQWESLVETTIAGARPEQAEGGQ
SEAEV
NT seq 1278 nt NT seq  +upstreamnt  +downstreamnt
gtgcggaagcgtcccgacgttttgatcctcggcctcaactacccgcctgaaccaaccgga
atcgcgccctacacgggagcgctggcatccggcctgaactcactcgggcgccacgtcact
gcgcaggttgcccatccccattaccctgagtgggtcgtgcgtgagggttatgggcagtgg
tcgcgcgtagagcaactcgatggtgttgaggtaaggcgccttctccattatgttccgaag
tcacctcgtggattgcggcgattgttgtcggagaccagttttggtctgcgccttctcttc
gcgcgctggggccgcccccgtatcgtcatcaccgtctcgccgtcactattctcggcggcg
ttggctgccctacggatacggctcaccccccgtcgaccgcccttcattgtttggattcaa
gatatctacacgctcggattggcggaaaccggggaagggggcgggttcgcggcgaccctc
acccgatgggtggaatctcgcactctgcgctcggcggaccgcgtcgtcgtcatccatcac
cgcttcgctgattacgtagcgcgcgaactcggagtgaaagcgtccgacgttgtagtggtt
cgcaattgggcacatcttgcgatggaaatgcccgttagttcggcttctgcgaagttggcg
ttgggttggcccagcggcgtgatactggccgtccacaccgggaacatgggactgaagcag
gggcttgagaacatcgtcgatgccgcgcgtgaggccgatgaacgcagtgcacccgtgcat
ttcttgcttgtgggcgacggtggcgagaggcgcaagctcatggagcgtgcacacggtata
tcgcgcatcactttcgtcgggccgctgagcgacgcggattaccgcttagcgctgagcgct
gccgacgttctcctcgtcaacgagaagccagggatctcgtctatggccgtgcccagtaaa
cttacgtcgtacttccacgcgggcaggccggtaattgcggccactgacgctgatggaata
accgcgtcggaagtgctggctgctggcgccggaatcgtcgtacccgccggcgagcacagt
gctctgttggatgccgtgctggacctgggtgacgaccctgcggcggcagcacgattcggg
cgaaacgggcggcgatatcgggaatccgtgctggatgagcaagtagccatcgcgcagtgg
gagagtctcgtcgaaacaacgattgccggtgcgcggcccgaacaggcagagggggggcaa
tcagaagctgaggtatag

DBGET integrated database retrieval system