KEGG   Mycobacterium sp. KMS: Mkms_1162Help
Entry
Mkms_1162         CDS       T00442                                 

Definition
(GenBank) glutamate decarboxylase
  KO
K01580  glutamate decarboxylase [EC:4.1.1.15]
Organism
mkm  Mycobacterium sp. KMS
Pathway
mkm00250  Alanine, aspartate and glutamate metabolism
mkm00410  beta-Alanine metabolism
mkm00430  Taurine and hypotaurine metabolism
mkm00650  Butanoate metabolism
mkm01100  Metabolic pathways
mkm01110  Biosynthesis of secondary metabolites
mkm01120  Microbial metabolism in diverse environments
mkm02024  Quorum sensing
Module
mkm_M00027  GABA (gamma-Aminobutyrate) shunt
Brite
KEGG Orthology (KO) [BR:mkm00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00650 Butanoate metabolism
    Mkms_1162
  09105 Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    Mkms_1162
  09106 Metabolism of other amino acids
   00410 beta-Alanine metabolism
    Mkms_1162
   00430 Taurine and hypotaurine metabolism
    Mkms_1162
 09140 Cellular Processes
  09145 Cellular community - prokaryotes
   02024 Quorum sensing
    Mkms_1162
Enzymes [BR:mkm01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.15  glutamate decarboxylase
     Mkms_1162
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Pyridoxal_deC Aminotran_5
Motif
Other DBs
NCBI-ProteinID: ABL90375
UniProt: A1UC17
LinkDB All DBs
Position
1247917..1249302
Genome map
AA seq 461 aa AA seqDB search
MSRTHSRVQHVSPAYTGRLAMAPVPSLRLPDEAMEPQAAYRFIHDELMLDGSSRLNLATF
VTTWMDPEAEKLMAETFDKNMIDKDEYPATAAIEQRCVCMVADLFHAEDLRDDDPNSAIG
VSTIGSSEAVMLAGLAMKWRWRQRLGGDAWKGRTPNLVMGSNVQVVWEKFCRYFDVEPRY
LPMEDGRYVITPEQVLEHVDEDTIGVVAILGTTYTGELEPIGEICAALDKLAADGGVDVP
VHVDAASGGFVVPFLHPDLVWDFRLPRVVSINVSGHKYGLTYPGIGFVVWRNAEQLPEEL
VFRVNYLGGDMPTFTLNFSRPGNQVVGQYYNFLRLGRGGYAQVMQSLSQTARWLGDELRD
SEHFELITDGSAIPVVSFRLKGDPGYTEFDISQTLRSYGWQVPAYTMPEGAEDVTVLRVV
VREGFSADLARALRDDMVTVLKHLDELKPGGHFDEVQPFAH
NT seq 1386 nt NT seq  +upstreamnt  +downstreamnt
atgtcgcgcacgcacagtcgcgtccagcacgtctcgcccgcctacaccggcaggttggcg
atggcgccggtgccgtcactgcggctgcccgacgaggcgatggaaccccaggcggcctac
cggttcatccacgacgaactcatgctcgacggcagctcgcggctcaacctcgccaccttc
gtcaccacgtggatggaccccgaggccgagaagctgatggccgagacgttcgacaagaac
atgatcgacaaggacgagtacccggcgaccgcggcgatcgagcagcgttgcgtgtgcatg
gtggccgacctgttccacgccgaggatctgcgcgacgacgacccgaacagcgcgatcggg
gtgtcgacgatcgggtcgagcgaggcggtcatgctcgccgggctggcgatgaaatggcgt
tggcgccagcgcctcggcggcgatgcgtggaagggccgcaccccgaatctggtgatgggg
tcgaacgtccaggtggtgtgggagaagttctgccgctacttcgacgtcgaaccgcgctat
ctgccgatggaggacggtcgctacgtcatcactccggagcaggtgctcgagcacgtcgac
gaggacaccatcggagtggtggcgatcctgggcaccacctacaccggtgaactggagccc
atcggggagatctgcgccgcgctcgacaaattggccgcagacgggggtgtcgacgtgccc
gtccacgtcgacgccgccagcggcgggttcgtggtgccgttcctgcatccggatctggtg
tgggacttccggttgccgcgggtggtgtcgatcaacgtcagtggacacaagtacgggctc
acctatcccggcatcgggttcgtggtgtggcgcaacgccgagcagctacccgaggaactg
gtgttccgggtcaactacctcggcggcgacatgccgacgttcacgctgaacttctctcgt
cccggtaaccaggtggtcggccagtattacaacttcctgcggttgggtcgcggcggctac
gcgcaggtcatgcagtcgctgtcgcagaccgcccggtggctgggcgacgaactgcgcgac
agcgagcatttcgagttgatcaccgacggttcggcgatcccggtcgtgagcttccggttg
aagggcgacccgggctacaccgagttcgacatctcgcagacgttgcgctcctacggctgg
caggtgcccgcgtacaccatgcccgagggcgccgaggacgtcacggtgctcagggtcgtg
gtacgcgaggggttttccgccgatctggcccgcgcgctgcgcgacgacatggtcacggtg
ctcaagcatctcgacgagctcaagccgggtggccacttcgatgaggtgcagccgttcgcc
cattag

DBGET integrated database retrieval system