KEGG   Mycobacterium sp. KMS: Mkms_1647
Entry
Mkms_1647         CDS       T00442                                 

Definition
(GenBank) phthalate 3,4-dioxygenase, alpha subunit
  KO
K18251  phthalate 3,4-dioxygenase subunit alpha [EC:1.14.12.-]
Organism
mkm  Mycobacterium sp. KMS
Pathway
mkm00624  Polycyclic aromatic hydrocarbon degradation
mkm01100  Metabolic pathways
mkm01120  Microbial metabolism in diverse environments
mkm01220  Degradation of aromatic compounds
Module
mkm_M00636  Phthalate degradation, phthalate => protocatechuate
Brite
KEGG Orthology (KO) [BR:mkm00001]
 09100 Metabolism
  09111 Xenobiotics biodegradation and metabolism
   00624 Polycyclic aromatic hydrocarbon degradation
    Mkms_1647
Enzymes [BR:mkm01000]
 1. Oxidoreductases
  1.14  Acting on paired donors, with incorporation or reduction of molecular oxygen
   1.14.12  With NADH or NADPH as one donor, and incorporation of two atoms of oxygen into the other donor
    1.14.12.-  
     Mkms_1647
SSDB
Motif
Pfam: Ring_hydroxyl_A Rieske
Other DBs
NCBI-ProteinID: ABL90854
UniProt: A1UDE6
LinkDB
Position
1763095..1764549
AA seq 484 aa
MQDHGEVLAAVRTGMIPAHVYNDKQIFSLEKERLFSRAWLFVAHESEIPQPGDYVVRQVL
QDSFIVARDSAGEIRVMFNMCLHRGMQVCRAEMGNASNFRCPYHGWSYRNDGRIIGLPFH
QEAYGGDAGFNKTGQTLLPAPSVASYNGLIFLSMDPDAESLEDYLGDFRFYLDFYTKQGP
NGLEVRGPQRWRVKANWKIAAENFAGDMYHTPQTHTSVVEIGLFREPKANKRKDGATYWA
GRGGGTTYKLPEGSFEDRMSYVGYPADMISRAKATWTEQQQQVVGTDGFMISAATCFPNI
SFVHNWPKVEDGEHVLPFISIRVWQPISENETEVLSWFAVDSDAPADFKADSYKAYLMCF
GSTGMFEQDDVENWVSLTNTAGGSMARRLRLNSRMGLLADDARVVDTLSSAQFHGPGYAQ
LGYNENNQRELLRLWADYLDMPPLRVDPATVLTDNPQGIEPMVQTNGGAVAGIDSESATT
SVTL
NT seq 1455 nt   +upstreamnt  +downstreamnt
atgcaggatcacggtgaggtgttagcggctgtacgcactggcatgatcccggcgcacgtg
tataacgacaagcaaattttctcgctcgagaaggagcgcctgttcagtcgggcgtggttg
ttcgtggcgcacgagtcggagattccgcagccgggggactacgtggtcagacaagtgttg
caggattcgttcatcgtcgctcgtgattctgccggcgagatccgggtgatgttcaatatg
tgcctccatcgcggtatgcaggtttgccgggcggaaatggggaacgcgtcgaacttcaga
tgcccgtaccacgggtggtcttaccgcaatgacggtcgcattattggcctgccgtttcac
caagaggcttacggaggagacgccgggtttaacaagacggggcagaccttgttgcccgcg
ccgagtgtggccagctacaacgggttgatctttctgtcgatggatcctgacgcagaatcg
cttgaagactatctgggtgatttcaggttctatctcgatttctacaccaagcaaggcccc
aacggtcttgaggtgcgaggtccgcagcgttggcgggtaaaagcgaactggaagatcgca
gctgaaaatttcgccggggacatgtaccacacacctcagacgcacacgtcggtggtcgag
atcggcctgttccgagagccgaaggctaacaagcgcaaagacggcgccacgtattgggcg
ggtagaggtgggggcaccacatacaagctgcccgaggggagtttcgaggaccggatgagc
tacgtgggctacccggcggacatgattagtcgagccaaggccacctggaccgagcagcag
caacaagtcgtcggcaccgacgggttcatgatctcggccgcgacgtgttttcccaacatc
agtttcgtgcacaactggccgaaagtggaggacggggagcacgtcttgccgttcatttca
atccgggtgtggcagccaatcagcgagaacgaaaccgaggtgctgtcgtggtttgcggtg
gattctgatgccccggcagactttaaggcggactcgtataaggcttatttgatgtgcttc
ggctcgacgggaatgttcgagcaagacgatgtcgagaactgggtgtcgctgaccaacacc
gcggggggttccatggcccgccgactgcggctgaacagccggatggggctgctcgcagac
gatgcccgggtggtcgacaccctaagcagcgctcaattccacgggcctggatacgctcag
ctcggctacaacgagaacaatcaacgggaattgttgaggctctgggccgactacctcgac
atgccgccgctgcgagtcgacccggctactgtgctcacggacaacccgcaaggtattgag
ccgatggtgcagaccaacggcggggccgtcgccggtatcgactcggagtcggctacgacg
tcggtgacgctgtga

DBGET integrated database retrieval system