KEGG   Mycobacterium sp. KMS: Mkms_1648
Entry
Mkms_1648         CDS       T00442                                 

Definition
(GenBank) phthalate 3,4-dioxygenase, beta subunit
  KO
K18252  phthalate 3,4-dioxygenase subunit beta [EC:1.14.12.-]
Organism
mkm  Mycobacterium sp. KMS
Pathway
mkm00624  Polycyclic aromatic hydrocarbon degradation
mkm01100  Metabolic pathways
mkm01120  Microbial metabolism in diverse environments
mkm01220  Degradation of aromatic compounds
Module
mkm_M00636  Phthalate degradation, phthalate => protocatechuate
Brite
KEGG Orthology (KO) [BR:mkm00001]
 09100 Metabolism
  09111 Xenobiotics biodegradation and metabolism
   00624 Polycyclic aromatic hydrocarbon degradation
    Mkms_1648
Enzymes [BR:mkm01000]
 1. Oxidoreductases
  1.14  Acting on paired donors, with incorporation or reduction of molecular oxygen
   1.14.12  With NADH or NADPH as one donor, and incorporation of two atoms of oxygen into the other donor
    1.14.12.-  
     Mkms_1648
SSDB
Motif
Pfam: Ring_hydroxyl_B SnoaL_4
Other DBs
NCBI-ProteinID: ABL90855
UniProt: A1UDE7
LinkDB
Position
1764546..1765142
AA seq 198 aa
MTVDDQRTGRPMAPSVLGAHAARAQRVGDPLPFDDSRHLEAHRFLVNEAYLLDAQDYDRW
LGVLTEDIHYYMPVRITTAAGAGFDSSPGMAHFDENKYSLSRRVARFATEHAWTEDPPSR
LRHFITNVRTFLTDDADHLAVDSAELLFRSRGDVNESTLLSCGREDLLRRDGNALKLARR
TIAVDESVLRMQNLAVFL
NT seq 597 nt   +upstreamnt  +downstreamnt
gtgaccgtcgacgatcaacgcactggtcgacccatggccccatcggtactcggtgcgcac
gccgcgcgcgcccaacgcgtcggcgacccgttaccgttcgacgattctcgccatctggag
gcgcatcgcttcctcgtcaacgaggcgtacctcctcgatgcccaagactacgacaggtgg
ctgggtgttcttaccgaggacattcactattacatgccggtgcggatcaccaccgccgcc
ggcgccggattcgatagctcaccgggaatggcgcatttcgacgagaacaaatactcactc
agtcgccgcgttgcccgattcgccaccgagcatgcctggactgaggatccgccgtcgcgc
ctgcgccacttcatcaccaacgtgcgcacattcctcaccgacgacgccgaccacctcgcg
gtcgacagcgctgagttgttgttccgcagccgcggcgacgtcaatgagtccacgctcctc
tcatgcggtcgtgaagatcttctacgtcgcgatggcaacgccctcaaactcgcccggcgc
acaatcgccgtcgatgaatcagtgcttcgaatgcagaatctggcggtattcctatga

DBGET integrated database retrieval system