KEGG   Mycobacterium sp. KMS: Mkms_1975Help
Entry
Mkms_1975         CDS       T00442                                 

Definition
(GenBank) D-alanine--D-alanine ligase
  KO
K01921  D-alanine-D-alanine ligase [EC:6.3.2.4]
Organism
mkm  Mycobacterium sp. KMS
Pathway
mkm00473  D-Alanine metabolism
mkm00550  Peptidoglycan biosynthesis
mkm01100  Metabolic pathways
mkm01502  Vancomycin resistance
Brite
KEGG Orthology (KO) [BR:mkm00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00473 D-Alanine metabolism
    Mkms_1975
  09107 Glycan biosynthesis and metabolism
   00550 Peptidoglycan biosynthesis
    Mkms_1975
 09160 Human Diseases
  09175 Drug resistance: antimicrobial
   01502 Vancomycin resistance
    Mkms_1975
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01011 Peptidoglycan biosynthesis and degradation proteins [BR:mkm01011]
    Mkms_1975
Enzymes [BR:mkm01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.2  Acid-D-amino-acid ligases (peptide synthases)
    6.3.2.4  D-alanine---D-alanine ligase
     Mkms_1975
Peptidoglycan biosynthesis and degradation proteins [BR:mkm01011]
 Precursor biosynthesis
  Amino acid ligase
   Mkms_1975
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Dala_Dala_lig_C Dala_Dala_lig_N ATP-grasp ATP-grasp_3 RimK CPSase_L_D2 ATP-grasp_4 ATPgrasp_ST
Motif
Other DBs
NCBI-ProteinID: ABL91174
UniProt: A1UEB6
LinkDB All DBs
Position
2094540..2095655
Genome map
AA seq 371 aa AA seqDB search
MIARNQRTRVAVVYGGRSSEHAISCVSAGSILRNLDPERFDVVAVGITPDGSWVLTDGRP
ETLAITDGRLPEVSAESGTALALPADPGRRGELVSLSPAAAGEVLAAVDVVFPVLHGPYG
EDGTIQGLLELAGVPYVGAGVLASAAGMDKEFTKKLLVAEGLPVGDHVVLRPGRANVTLD
ERERLGLPVFVKPARGGSSIGVSRVSDWAELPAAIEAARRHDPKVIVEAGIAGRELECGV
LEYPDGRVDASTIGEIRVAGVRGREDGFYDFATKYLDDGAELDVPAKVEDDVADEIRRLA
IRAFRAIDCQGLARVDFFLTDDGPVVNEINTMPGFTTISMYPRMWAASGVDYPTLLAAMV
DTAVARGTGLR
NT seq 1116 nt NT seq  +upstreamnt  +downstreamnt
gtgatcgcccgcaaccagcgcacccgcgttgccgtcgtctacggcgggcgcagttccgaa
cacgccatctcctgcgtttccgcaggcagcatcctgcgcaacctcgaccccgaacgcttc
gacgtggtcgccgtcgggatcactcccgacgggtcctgggtgctcaccgacggccggccg
gagacgctggccatcaccgacggccggctccccgaggtgagcgccgagtccggtaccgcc
ctggcgctgcccgccgacccgggccgccgcggtgagctggtgtcgctgagcccggcggcg
gcaggggaggtgctcgccgcggtcgacgtggtgttcccggtgctgcacggcccctacggc
gaggacggcacgatccagggtctgctggaactggccggggtgccctacgtcggggcgggc
gtactggccagcgccgcgggcatggacaaggagttcacgaagaagctgctggtcgccgag
ggcctgccggtcggcgatcacgtggtgctgcgtcccggacgcgcgaacgtgacgctcgac
gaacgcgaacgcctcggcctgccggtgttcgtcaaacccgcgcgcgggggctcctcgatc
ggggtcagccgggtgtcggactgggcggaactgcccgccgcgatcgaggcggcccgcaga
cacgatcccaaggtcatagtcgaggccggcatcgcgggtcgcgaactcgaatgcggcgtg
ctggagtatccggacggccgcgtcgacgccagcaccatcggcgagatccgggtggccggg
gtgcggggccgcgaggacggtttctacgacttcgccaccaagtacctcgacgacggcgcc
gaactcgacgtgcccgccaaggtcgaggacgacgtggccgacgagatccgccgcctcgcc
atccgggcgtttcgggcgatcgactgccaggggctggcgcgggtcgacttcttcctcacc
gacgacggaccggtggtcaacgagatcaacaccatgccgggtttcaccacgatctcgatg
tatccgcggatgtgggcggccagcggagtggactatccgacgctgctcgcggcgatggtc
gacacagcggtggcccgcggaacgggtctgcgctag

DBGET integrated database retrieval system