KEGG   Mycobacterium sp. KMS: Mkms_2321Help
Entry
Mkms_2321         CDS       T00442                                 

Definition
(GenBank) 4-aminobutyrate aminotransferase apoenzyme
  KO
K07250  4-aminobutyrate aminotransferase / (S)-3-amino-2-methylpropionate transaminase [EC:2.6.1.19 2.6.1.22]
Organism
mkm  Mycobacterium sp. KMS
Pathway
mkm00250  Alanine, aspartate and glutamate metabolism
mkm00280  Valine, leucine and isoleucine degradation
mkm00410  beta-Alanine metabolism
mkm00640  Propanoate metabolism
mkm00650  Butanoate metabolism
mkm01100  Metabolic pathways
mkm01120  Microbial metabolism in diverse environments
Module
mkm_M00027  GABA (gamma-Aminobutyrate) shunt
Brite
KEGG Orthology (KO) [BR:mkm00001]
 Metabolism
  Carbohydrate metabolism
   00640 Propanoate metabolism
    Mkms_2321
   00650 Butanoate metabolism
    Mkms_2321
  Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    Mkms_2321
   00280 Valine, leucine and isoleucine degradation
    Mkms_2321
  Metabolism of other amino acids
   00410 beta-Alanine metabolism
    Mkms_2321
Enzymes [BR:mkm01000]
 2. Transferases
  2.6  Transferring nitrogenous groups
   2.6.1  Transaminases
    2.6.1.19  4-aminobutyrate---2-oxoglutarate transaminase
     Mkms_2321
    2.6.1.22  (S)-3-amino-2-methylpropionate transaminase
     Mkms_2321
Amino acid related enzymes [BR:mkm01007]
 Aminotransferase (transaminase)
  Class III
   Mkms_2321
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Aminotran_3 Aminotran_1_2
Motif
Other DBs
NCBI-ProteinID: ABL91519
UniProt: A1UFB1
LinkDB All DBs
Position
complement(2430431..2431771)
Genome map
AA seq 446 aa AA seqDB search
MSTLEQSRHLATAIPGPKSQQLIDRKAAAVSRGVGTTMPVYAARAQGGIVEDVDGNRLID
LGSGIAVTTIGNAAPRVVEAVAAQAGRFTHTCFMVTPYEGYVAVAEALNRLTPGSGEKRS
ALFNSGSEAVENAVKIARSYTHKSAVVSFDHAYHGRTNLTMALTAKVMPYKHGFGPFAPE
IYRAPLSYPFRDAEFGKELATDGELAARRAIDVMDKQVGADNLAAVIIEPIQGEGGFIVP
AEGFLPTLLDWCRRNDVVFIADEVQTGFARTGRMFACEHEGIEPDLIVTAKGIADGMPLS
AVTGRAEIMDSPHVSGLGGTYGGNPVACAAALATIETIESENLVERAAAIGALMKDRLGR
LQAEDDRIGDVRGRGAMIAVELVKPGTTEPDAALAKALAAGAHTAGVIVLTCGTYGNVLR
FLPPLAISDELLDEGLDVVAGLLRDL
NT seq 1341 nt NT seq  +upstreamnt  +downstreamnt
gtgagcaccctcgagcagagccgccacctcgccacggccatccccggcccgaagtcgcag
cagctcatcgaccgcaaggccgccgccgtctcacgcggtgtcggcaccacgatgccggtg
tacgcggcgcgcgcccagggcggcatcgtcgaggacgtcgacggtaaccggctgatcgac
ctgggctcgggtatcgcggtcaccacgatcggcaacgcggccccccgcgtcgtggaggcc
gtcgccgcgcaggccgggcggttcacccacacctgtttcatggtcacgccgtacgagggg
tacgtggcggtcgccgaggcgctcaaccggctcacccccggtagcggcgagaaacgctcg
gcgctgttcaactccggttcggaggccgtcgagaacgccgtcaagatcgccaggtcctac
acccacaaatccgcggtggtgtccttcgaccacgcctaccacggtcgcaccaacctgacc
atggcgctgaccgccaaggtgatgccctacaagcacgggttcggaccgttcgcgccggag
atctaccgcgcgccgctctcctaccccttccgcgacgccgaattcggtaaggaactggcg
accgacggcgaactggccgcccgccgggcgatcgatgtgatggacaagcaggtcggcgcc
gacaatctggccgcggtgatcatcgaaccgatccagggcgagggtggtttcatcgtcccg
gcggaaggcttcctgcccaccctgctcgactggtgccgccgcaacgacgtcgtgttcatc
gccgacgaggtgcagaccggattcgcccgcaccgggcggatgttcgcgtgtgagcacgaa
ggcatcgaacccgacctcatcgtgacggccaagggcatcgccgacggtatgccgttgtcc
gcggtgacgggccgcgccgagatcatggactctccgcacgtgtcgggcctcggcggcacc
tacggcggcaacccggtcgcctgcgcggcggcactggccaccatcgagaccatcgaatcc
gagaacctggtcgaacgcgccgcggcgatcggggcgttgatgaaggaccggctgggtcgg
ctgcaggccgaggacgaccgcatcggcgacgtgcgcggacgcggcgccatgatcgcggtg
gagctggtgaaaccgggcaccaccgaaccggacgccgccctggccaaggcgctggccgcc
ggcgcgcacaccgccggggtgatcgtgctgacgtgcggcacgtacggcaacgtgttgcgt
ttcctaccgccgttggccatcagcgacgagttgctcgacgaagggctcgacgtggtggcc
ggtctcctgcgcgacctctga

DBGET integrated database retrieval system