KEGG   Mycobacterium sp. KMS: Mkms_2400Help
Entry
Mkms_2400         CDS       T00442                                 

Definition
(GenBank) shikimate kinase
  KO
K00891  shikimate kinase [EC:2.7.1.71]
Organism
mkm  Mycobacterium sp. KMS
Pathway
mkm00400  Phenylalanine, tyrosine and tryptophan biosynthesis
mkm01100  Metabolic pathways
mkm01110  Biosynthesis of secondary metabolites
mkm01130  Biosynthesis of antibiotics
mkm01230  Biosynthesis of amino acids
Module
mkm_M00022  Shikimate pathway, phosphoenolpyruvate + erythrose-4P => chorismate
Brite
KEGG Orthology (KO) [BR:mkm00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    Mkms_2400
Enzymes [BR:mkm01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.71  shikimate kinase
     Mkms_2400
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: SKI AAA_33 AAA_18 AAA_17 Cytidylate_kin2 Mg_chelatase Cytidylate_kin KTI12 AAA_5 AAA MMR_HSR1 AAA_24 AAA_22 6PF2K AAA_28 Gly_kinase CoaE AAA_16 Viral_helicase1
Motif
Other DBs
NCBI-ProteinID: ABL91598
UniProt: A1UFJ0
LinkDB All DBs
Position
2517999..2518706
Genome map
AA seq 235 aa AA seqDB search
MAPRAVLVGLPGSGKSTIGRRLAKALGLTLLDTDAAIEETTGRTIADIFATDGEQEFRRI
EEEVIRSALQTHDGVLSLGGGAVTTPGVRDALAGHTVIYLEISAAEGVRRTGGSTVRPLL
AGPDRAEKYKALMDARVPLYRRVATMRVNTNRRNPGAVVRHIVARLEKSAPRAEAATPAP
PTPNRPRRRRRPPWRRDAAKDQQESDGPPTPAIMAARAAERASDPHRDTTLEKNT
NT seq 708 nt NT seq  +upstreamnt  +downstreamnt
atggcgccgcgggcagtactggtcggcctgcccgggtcgggcaagtcgaccatcggccgt
cgcctcgccaaggcgctggggctgacgctgctcgacaccgacgccgcgatcgaggagacc
accgggcgcacgatcgccgacatcttcgccaccgacggtgagcaggagttccggcgtatc
gaggaggaggtcatccgctcggcgctgcagacccacgacggtgtgctctcgctcggcggc
ggggccgtcaccaccccgggtgtgcgcgatgcgctggccgggcacaccgtgatctacctg
gagatcagcgccgccgaaggggtgcgccgcaccggcggcagcaccgtccgtccgctgctc
gccggacccgaccgcgccgagaagtacaaggccctgatggacgcccgcgtcccgctgtac
cggcgggtggccaccatgcgggtgaacaccaaccggcgtaatcccggcgccgtggtccgc
cacatcgtcgcccggctcgagaagtccgctccgcgggccgaggcggccacccccgcgccg
cccacgccgaaccggccgcggcgccgtcgtcgcccaccgtggcggcgtgacgccgcgaag
gaccagcaggagtccgacggcccgccgacgcccgcgatcatggccgcccgcgcggcggag
cgggcatcggatccccatcgcgatacgaccctggagaagaacacgtga

DBGET integrated database retrieval system