KEGG   Mycobacterium sp. KMS: Mkms_3721Help
Entry
Mkms_3721         CDS       T00442                                 

Definition
(GenBank) fatty acid synthase, bacterial type
  KO
K11533  fatty acid synthase, bacteria type [EC:2.3.1.-]
Organism
mkm  Mycobacterium sp. KMS
Pathway
mkm00061  Fatty acid biosynthesis
mkm01100  Metabolic pathways
mkm01212  Fatty acid metabolism
Module
mkm_M00082  Fatty acid biosynthesis, initiation
mkm_M00083  Fatty acid biosynthesis, elongation
Brite
KEGG Orthology (KO) [BR:mkm00001]
 09100 Metabolism
  09103 Lipid metabolism
   00061 Fatty acid biosynthesis
    Mkms_3721
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01004 Lipid biosynthesis proteins [BR:mkm01004]
    Mkms_3721
Enzymes [BR:mkm01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.-  
     Mkms_3721
Lipid biosynthesis proteins [BR:mkm01004]
 Fatty acid synthase
  Bacteria type
   Mkms_3721
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DUF1729 Acyl_transf_1 ketoacyl-synt MaoC_dehydratas Ketoacyl-synt_C DNA_pol_B_N SAT Fas_alpha_ACP FAS_I_H adh_short Patatin
Motif
Other DBs
NCBI-ProteinID: ABL92915
UniProt: A1UJA7
LinkDB All DBs
Position
complement(3931259..3940492)
Genome map
AA seq 3077 aa AA seqDB search
MTIYEHDRVSTSWDDESGAKTTHALVDRLTAGEPFAVAFGGQGSAWLETLEELVSSTGIE
SELATLAGEAELLLEPVARELVVVRPIGFEPLRWVRALAAEEPVPTAKQLTSAAVSVPGV
LLTQVAAVRALARQGMDLFETPPVATAGHSQGVLAVEALAAQGAKDVELLALAQLIGAAG
TLVARRRGITVLGDRPPMVSVTNADPERIYELLEEFSTDVRTVLPPVLSIRNGRRSVVIT
GTPEQLSRFELYCTQIAEKEEAERKNKLRGGAVFAPAFDPVQVEVGFHTPRLADGIDIVG
RWAEAVGLDVALARQMTEAILVNQVDWVDEVTELHDAGARWILDLGPGDILTRLTAPVIR
GLGVGIVPAATRGGQRNLFTVGAVPEVARPWSSYTPTAVRLPDGSVKLSTKFTRLTGRSP
ILLAGMTPTTVDAKIVAAAANAGHWAELAGGGQVTEEIFNARIDELAGLLEPGRAIQFNS
LFLDPYLWKLQLGGKRLVQKARQSGAPIDGVVVTAGIPELEEAVDLIDELNGIGISHIVF
KPGTVEQIRSVIRIAAEVPTKPVIVHIEGGRAGGHHSWEDLDDLLLTTYSELRSRSNITI
CVGGGIGTPERAAEYLSGRWSQVYGFPVMPVDGILVGTAAMAALEATTSPAVKQLLVDTT
GTDQWVGAGKAQGGMASGRSQLGADIHEIDNAASRCGRLLDEVAGDADAVAERRDEIIAA
MAATAKPYFGDVAEMTYLQWLARYVELAIGEGDSTADTSRAGSPWLDITWRDRFAQMLQR
AEARLHPQDHGPIDTVFSGSAGSELLETPQAAIDALVNRYPDAETVLLHPADVPFFVQLC
KTLGKPVNFVPVIDKDVRRWWRSDSLWQAHDARYTADQVCIIPGTAAVAGITRVDEPVGE
LLDRFEQAAVDEVLAADGGPRPVTSRRQGRTDVVGPLAVLLDAPDVLWAGRTAVNPVHRI
AASADWQVRDEGRTATHASTGARLEVADDQHVVLSVPLSGTWIDIRFTLTDVIRTGGAPL
VTTEDAATAMRSVLAIAAGVEEGPSGLPPVHDGTATATVVWDPELVADHTGVTATFGAPL
APTLTVVPDALVGRCWPAVFAAIGSAATDSGFPVVEGLLSLVHLDHGAQLVAALPKDRTD
LTVTATAGTATDTEVGRVVPVSVTVADADGTLLATLEERFAIRGRTGAAELSDPARAGGA
ISDNATDTPRRRRRDVVVSAPVDMRPFAVVSGDHNPIHTDRAAALLAGLESPIVHGMWLS
AAAQHVVTATDGKAVPPARLVGWTARFLGMVLPGDEIDFRVDRVGIDVGAEVLEVTAKVG
TDLVMSATARLAAPKTVYAFPGQGIQHKGMGMEVRARSKAARKVWDSADKFTRETLGFSV
LHVVRDNPTSLIASGVHYQHPEGVLYLTQFTQVAMATVAAAQVAEMREQGAFVEGAIACG
HSVGEYTALACVSGVYELEALLEVVFHRGSKMHDIVPRDELGRSNYRLAAIRPSQIDLDD
ADVKDFVAEIAARTGEFLEIVNFNLRGAQYAIAGTVRGLEALEEEIERRRELSGGKRSFI
LVPGIDVPFHSSVLRVGVADFRRSLERVMPRDADPELLIGKYIPNLVPRPFTLDRDFVEE
IRDLVPAEPLDEVLADYDTWRNEKPKELCRKIVIELLAWQFASPVRWIETQDLLFIEEAA
GGLGVERFVEIGVKSAPTVAGLATNTLKLPEYSHSTVEVLNSERDAAVLFATDEDPVVDP
EPEAEAPAAETAPAAESPAPAAPAAPAAPSGGPRPDDITFDAADATVALVALSAKMRLDQ
IEALDSIETITDGASSRRNQMLVDLGSELNLGAIDGAAEADLGALKGQVTKLARTYKPFG
PVLSDAINDQLRTVLGPSGKRPAYIAERVGKAWELGAGWAKHVTVEVALGTREGSSVRGG
SLGGLHDGALADAATVDKVIDAAVAAVAARRGVAVSLPSAGGGGGGVVDSAALGEFAEQV
TGRDGVLANAARLVLGQLGLDTPVTPSESATDAELIDLVTAELGSDWPRLVAPAFDGRKA
VVFDDRWASAREDLVKIWLADEDDIDTDWPKLSERFEGAGHVVATQANWWQGRALAAGRN
VHASLFGRIAAGAENPGKGRYSDEVAVVTGASKGSIAAAVVGQLLDGGATVIATTSRLDD
ARLAFYKTLYRDNARYDAKLWVVPANMASYSDIDALVKWVGTEQVESLGPQSIHLKDAQT
PTLLFPFAAPRVAGDMSEVGSRSEMEMKVLLWAVQRLIGGLSSIGAERDIASRLHVVLPG
SPNRGMFGGDGAYGEAKASLDALVNRWKAETSWAQRVSLAHALIGWTKGTGLMGHNDAIA
GAVEEAGVTTYTTAEMASMLLSLCDIESKVAAAREPIKADLTGGLGDIELDMAALAAKAR
EEMSTDAADEDADAPAPGTIAALPSPPRGYTPAPPPEWADLDVDPADLVVIVGGAELGPY
GSSRTRYEMEVDNELSAAGVLELAWTTGMIKWEDDPKPGWYDAASGDLVPEEELVERYHD
AVVERCGIREFVDDGAIDPDHASPLLVSVFLDKDFSFVVSSEEEARTFVDFDPEHTVVRP
VPDSSDWQVIRKAGTEIRVPRKTKLSRTVGAQIPTGFDPTVWGITPDMANSIDRVALWNI
VATVDAFLSAGFTPTELMRWVHPSLVASTQGTGMGGMTSMQTMYHGNLLGRNKPNDILQE
VLPNVVAAHVVQSYIGSYGAMIHPVGACATAAVSVEEGVDKIRLGKAELVVTGGFDDLTL
EAIIGFGDMAATADTEMMRAKGISDSKFSRANDRRRLGFVEAQGGGTILLARGDLAVKMG
LPVLAVVAYAQSFADGVHTSIPAPGLGALGAGRGGKDSVLARSLNKLGVGADDISVIYKH
DTSTLANDPNETELHERLADSLGRSDGAPLFIVSQKTLTGHAKGGAAVFQMMGLCQVLRD
GVIPPNRSLDCVDDEMATSGHFVWPRETLRMGEKFPLKAGLVTSLGFGHVSGLIALVHPQ
AFLSTLAPEQRDDYVARAEQRTLAGQRRLASAIAGGRPMYERPDGRRFSHDEPEKRQEAA
MLLDAASRLGDGDVYVR
NT seq 9234 nt NT seq  +upstreamnt  +downstreamnt
gtgacgatctacgagcatgacagggtttccacgagctgggacgacgagtccggagccaag
accactcatgcactggtggatcgcctgaccgcgggtgaaccgttcgcggtggccttcggc
gggcagggcagtgcgtggctggagacactcgaggagctggtgtcctcgaccggcatcgaa
tcggagctggccaccctcgccggtgaggccgagctgctgctcgagcccgtggcgagggaa
ctggtcgtcgtccggccgatcggcttcgagccgctccgctgggtgcgcgcgctggccgcc
gaggaaccggtcccgaccgccaagcagctgacgtcggcggccgtgtcggtccccggtgtc
ctgctgacccaggtcgccgccgtacgcgcgctggcccgccagggcatggacctgttcgag
acgccgcccgtcgcgaccgccgggcactcccagggtgtcctcgccgtcgaggcgctcgcc
gcccagggcgccaaggacgtcgaactgctggcgctggcgcagctgatcggtgcggcgggc
acgctggtggcccgtcgtcggggcatcacggtcctcggggaccgaccgcccatggtctcg
gtcaccaacgccgaccccgagcgcatctacgaattgctcgaggagttctccaccgacgtg
cgcacggtgctgccgccggtgctgtcgatccgcaacggccgccgctcggtcgtcatcacc
ggaacccccgagcaactgtcacgcttcgagctgtactgcacccagatcgccgagaaggaa
gaggccgagcgcaagaacaagctgcgcggcggcgcggtcttcgcgccggccttcgacccc
gtccaggtggaggtcggcttccacaccccgcgcctggccgacggcatcgacatcgtcggc
cggtgggccgaggcggtcgggctggacgtcgcgctcgcgcgccagatgaccgaggccatc
ctcgtcaaccaggtcgactgggtcgacgaggtcaccgaactccacgacgccggcgcccgc
tggattctcgacctggggccgggggacatcctgacccggctgaccgccccggtgatccgc
ggactcggggtgggcatcgtgcccgccgccacccgcggcggccagcgcaacctgttcacc
gtcggcgccgtgcccgaggtggcccgcccgtggtcgagctacaccccgaccgccgtccgg
ctgcccgacggctcggtgaagctgtccaccaagttcacccgcctgaccggccgatcgccc
atcctgctggccgggatgacgccgacgaccgtcgacgccaagatcgtcgccgcggcggcc
aacgccggccactgggccgaactcgccggcggcgggcaggtcaccgaggagatcttcaac
gcccgcatcgacgagttggccggactcctggagccgggccgcgcgatccagttcaactcg
ctgttcctcgacccgtacctgtggaagttgcagctcggcggcaagcggctggtgcagaag
gcccgccagtccggcgcccccattgacggcgtcgtggtcaccgcgggtatcccggagctc
gaagaggccgtcgacctgatcgacgagctcaacggcatcggcatcagccacatcgtcttc
aagccgggcaccgtcgagcagatccgctcggtcatccggatcgccgccgaggtccccacc
aaaccggtcatcgtgcacatcgagggcggccgcgccggtggccaccactcgtgggaggac
ctcgacgacctgctgctgacgacgtactcggagctgcgctcgcgctcgaacatcaccatc
tgcgtcggcggcgggatcggcacgcccgaacgggccgcggagtacctgtccggccggtgg
tcgcaggtctacgggttcccggtgatgcccgtcgacggcatcctcgtcggcaccgcggcg
atggccgcactggaggccaccacctcaccggcggtcaaacagctgctggtcgacaccacc
ggcaccgatcagtgggtcggggcgggtaaggcgcagggcgggatggcctccgggcgcagc
cagctcggcgccgacatccacgagatcgacaacgccgcatcgcgctgtggtcggctgctc
gacgaggtcgccggcgacgccgacgcggtcgccgagcgccgcgacgagatcatcgccgcg
atggctgcgaccgccaagccctacttcggtgacgtcgcggagatgacgtacctgcaatgg
ctggcccgttacgtcgaactcgccatcggcgagggcgacagcaccgccgacaccagccgc
gccggttcgccctggctcgacatcacctggcgcgaccggttcgcccagatgctgcagcgc
gccgaggcgcggctgcacccgcaggaccacggtccgatcgataccgtgttttcgggttct
gccggctcagagttgctggagaccccgcaggccgcgatcgacgcgctggtgaaccgctac
ccggacgccgagacggtgctgctgcacccggcggacgtgccgttcttcgtccagctgtgc
aagacgctcggcaaaccggtcaacttcgtgccggtcatcgacaaggacgtgcgccggtgg
tggcgcagcgattcgctgtggcaggcgcatgacgcccgctacaccgccgaccaggtctgc
atcattcccggcaccgccgccgtcgcgggcatcacccgcgtcgacgagcccgtcggcgag
ctgctcgaccgcttcgagcaggcggcggtcgacgaggtcctcgccgccgacggtggaccc
cggccggtgaccagccgtcgccagggccgcaccgatgtggtcggtccgctcgccgtgctg
ctcgacgcccccgacgtgctgtgggccggccgcaccgcggtcaaccccgtgcaccgcatc
gccgcctccgccgactggcaggtgcgcgacgagggccgcacggccacccacgcgtccacc
ggcgcccggctcgaggtggccgacgaccagcacgtggtgctcagcgtcccgctgtccggt
acctggatcgacatccgcttcacgctgaccgacgtcatccggaccggcggcgccccgctg
gtcaccaccgaggacgcggcgaccgcgatgcgctccgtgctggcgatcgccgccggcgtg
gaagaaggtccgtccggccttccgcccgtccacgacggaaccgcgacggccaccgtcgtc
tgggatccggaactggtcgccgaccacaccggcgtcaccgcgacgttcggcgccccgctg
gcgccgacgctgacggtcgtgccggatgcgctggtcggccgctgctggccggccgtgttc
gccgccatcggttccgcggcgaccgacagcggtttccccgtcgtcgagggtctgctgagc
ctggtgcacctcgaccacggcgcccagctcgtcgcggcgctgcccaaggaccgcaccgac
ctgaccgtcaccgccacggcgggtaccgccaccgacaccgaggtcggccgggtcgtgccg
gtgtcggtgaccgtcgccgacgccgacggcaccctgctggccacgctcgaggaacgcttc
gcgatccgcggccggaccggtgcggcggagctgagcgatccggcgcgtgccggcggcgcg
atctccgacaacgccaccgacaccccgcgtcgccggcgccgggacgtcgtggtctccgcg
ccggtggacatgcggccgttcgcggtcgtctccggtgaccacaacccgatccacaccgac
cgcgccgccgcgctgctggccggcctggagtcgccgatcgtgcacggcatgtggctgtcg
gccgccgcccagcacgtcgtcaccgccaccgacggcaaggccgtcccgccggcccgtctc
gtcggctggaccgcccgattcctgggcatggtgctgcccggtgacgagatcgacttccgc
gtcgaccgcgtcggtatcgacgtcggcgccgaggtgctcgaggtgaccgcgaaggtgggc
accgatctggtcatgtcggcgaccgcccgcctggcggcgccgaagaccgtctacgccttc
ccggggcagggcatccagcacaagggcatgggcatggaggtccgggcccgcagcaaggcc
gcccgcaaggtgtgggattcggcggacaagttcacccgcgagacgctcggcttctccgtg
ctgcacgtggtgcgcgacaacccgaccagcctcatcgcgtccggggtgcactaccagcat
cccgagggcgtgctgtacctgacgcagttcacccaggtcgcgatggccaccgtcgccgcc
gcgcaggtcgccgagatgcgtgagcagggtgcgttcgtcgaaggggcgatcgcctgcggt
cactccgtcggcgagtacaccgcgctggcatgtgtctcgggcgtctacgaactcgaggca
ctgctcgaggtggtgttccaccgcggcagcaagatgcacgacatcgtgccccgcgacgaa
ctgggccggtccaactaccggctggccgcgatccggccgagccagatcgatctcgacgac
gccgacgtcaaggacttcgtcgccgagatcgccgctcgcaccggagaattcctcgagatc
gtgaacttcaacctgcgtggcgcgcagtacgccatcgcgggcaccgtccgtgggctcgag
gcgctcgaggaggagatcgaacggcgtcgcgaactcagtggcggcaagcgctcgttcatc
ctcgtgcccggtatcgacgtgccgttccactcctcggtgctgcgggtcggcgtcgccgac
ttccgccgctccctggagcgggtcatgccgcgcgacgccgatccggaactgctgatcggc
aagtacatcccgaacctggtgccgcggccgttcacgctggaccgtgacttcgtcgaggag
atccgggatctggtgccggccgaaccgctcgacgaggtgctcgccgattacgacacctgg
cgcaacgagaagccgaaggagctgtgccgcaagatcgtcatcgagttgctggcctggcag
ttcgccagcccggtgcggtggatcgagacgcaggatctgctgttcatcgaggaggccgcg
ggcggactcggggtcgagcggttcgtcgagatcggcgtgaagtcggccccgacggtcgcc
gggctggccaccaacaccctcaaactgccggagtactcgcacagcacggtcgaggtgctc
aacagcgagcgcgacgccgcggtgctgttcgccacggatgaagatccggtcgtcgatccg
gaacccgaagccgaggcgccggccgccgagaccgctccggctgcggagagcccggcaccc
gcggccccggccgcacccgccgcaccgtcgggcggaccgcgtcccgacgacatcacgttc
gacgccgcggacgcgacggtggcgctggtcgcgctgtcggccaagatgcgtctcgaccag
atcgaggcgctcgactccatcgagaccatcaccgacggtgcgtcgtcgcggcgcaaccag
atgctggtcgacctgggttcggagctgaacctcggcgccatcgacggtgcggccgaggcc
gacctcggtgccctcaagggtcaggtcaccaagctggcccgcacctacaagccgttcggt
ccggtgctcagcgacgcgatcaacgatcagctccgcacggtgctcgggccgtccggtaag
cgtccggcctacatcgccgaacgcgtcggtaaggcatgggaactcggcgccggctgggcc
aagcacgtgaccgtcgaggtggcgctgggcacccgtgagggcagcagcgtccgcggcggg
agcctcggcggtctgcacgacggcgccctggccgacgcggcgaccgtcgacaaggtgatc
gacgccgccgtcgctgcggtggctgcgcgccgcggcgtcgcggtctccctgccctcggcg
ggcggtggcggtggcggcgtggtcgattcggcggcgctcggcgagttcgccgaacaggtc
accggacgcgacggtgtgctcgccaacgcggcccgcctggtgctgggccagctcggcttg
gacacgccggtcaccccgtccgaatcggcgaccgacgccgagctgatcgacctggtcacc
gccgaactcggttcggactggccgcgtctggtggcgccggcgttcgacggccgcaaggcc
gtggtgttcgacgaccggtgggccagcgcacgtgaggacctggtcaagatctggctggcc
gacgaggacgacatcgacaccgactggccgaagctgtccgagcgtttcgagggcgccggc
catgtcgttgccacgcaggcgaactggtggcaggggcgtgcgcttgcggcgggccggaac
gtgcacgcgtcgctgttcggccgcatcgcggccggcgcggagaaccccggcaaggggcgc
tacagcgacgaggtggcggtggtcaccggtgcctcgaagggttcgattgccgcggccgtg
gtggggcagttgctcgacggcggtgcgacggtcatcgcgaccacgtcgcgcctcgacgac
gcccggttggcgttctacaagacgctctaccgcgacaacgcccgctacgacgcgaagctg
tgggtggtgcccgcgaacatggcgtcgtactccgacatcgacgcgctggtgaagtgggtc
ggtacggagcaggtcgaaagccttgggccgcagtcgatccacctcaaggacgcccagacc
ccgacgctgctgttcccgttcgcggcgccgcgcgtcgccggggacatgtcggaggtcggt
tcgcgttccgagatggagatgaaggtgctgctgtgggccgtgcaacggctcatcggcggg
ctgtcgtcgatcggcgccgagcgtgacatcgcctcccgtctgcacgtcgtgctgcccggt
tcgccgaaccgcggcatgttcgggggggacggcgcctacggcgaggcgaaggcttcgctg
gatgcgctcgtcaaccggtggaaggccgaaacgtcttgggcgcaacgggtttcgctggcg
cacgcgctgatcggctggaccaagggcactgggttgatggggcacaacgacgccatcgcc
ggtgcggtcgaggaagccggcgtgacgacgtacaccaccgcggagatggcctcgatgctg
ctgtcgctgtgcgatatcgagtcgaaggtcgccgcggcccgcgagccgatcaaggccgat
ctgaccggcggcctcggtgacatcgagctcgacatggccgcgctggccgccaaggcccgc
gaggagatgtccaccgacgccgccgacgaggacgccgacgcaccagcgccgggcaccatc
gccgcgctgccgtcgccgccgcgcggatacaccccggccccgccgcctgagtgggccgac
ctcgacgtcgaccccgccgatctggtggtgatcgtcggcggcgccgaactcggcccgtac
gggtcgtcgcgcacccgctacgagatggaggtcgacaacgagctgtcggccgccggtgtc
ctcgaattggcttggaccacaggcatgatcaagtgggaggacgatcccaagcccgggtgg
tacgacgccgccagcggtgatctggtgcccgaggaggaactcgtcgagcgctaccacgac
gcggtcgtggagcggtgcggtatccgtgagttcgtcgacgacggtgcgatcgaccccgat
cacgcctcaccgctgctggtcagcgtcttcctcgacaaggacttcagcttcgtggtgtcc
tccgaggaggaggcgcgcacattcgtcgacttcgaccccgagcacaccgtggtgcgcccg
gtgccggattcctcggactggcaggtgatccgcaaggcgggcaccgagatccgcgttccg
cgcaagaccaagctgtcgcgcacggtgggcgcgcagatcccgaccggcttcgatccgacc
gtgtggggcatcacgcccgacatggccaactcgatcgaccgggtggcgctgtggaacatc
gtcgcgaccgtggatgcgttcctgtcggccggtttcaccccgaccgagctgatgcgctgg
gtgcaccccagcctggtggccagcacgcagggcaccggtatgggtggtatgacctcgatg
cagaccatgtaccacggcaacctgctcggccggaacaagccgaacgacatcctgcaggag
gtcctgccgaatgtcgttgccgcacacgtggtccagtcctacatcggctcctacggcgcg
atgatccacccggtcggcgcctgcgcaacggcggcggtgtcggtcgaggagggtgtcgac
aagatccggctcggcaaggccgaactggtggtgacgggcggattcgacgatctgacactc
gaggcgatcatcgggttcggtgacatggcggccaccgccgacaccgagatgatgcgcgcc
aaggggatcagcgattcgaagttctcccgtgccaacgaccggcgccggctgggcttcgtc
gaagcccagggtggcggcacgatcctgctggcccgtggtgacctcgcggtcaagatgggt
ctgccggtcctcgcggtcgtggcctacgcgcagagcttcgccgacggtgtgcacacctcg
atcccggctccggggctcggcgcactgggcgccggtcgcggtggcaaggattcggtgctg
gcccgctcgttgaacaagttgggcgtcggcgccgacgacatctcggtgatctacaagcac
gacacgtcgaccctggcgaacgatcccaacgagaccgaactgcacgagcggctcgccgac
tcgctgggccggtccgacggggcgccgctgttcatcgtcagccagaagacgctgaccggg
cacgccaagggcggcgcggcggtcttccagatgatggggctgtgccaggtgctgcgcgac
ggggtcatcccgccgaaccgcagcctggactgtgtcgacgacgagatggccacctccggg
cacttcgtctggccgcgggagaccctgcggatgggggagaagttcccgctcaaggccggt
ctggtgaccagcctcgggttcggccacgtctccgggttgatcgcactggtgcatccgcag
gcgttcctgtcgacgctcgctcccgagcagcgcgatgactacgtggcgcgcgcggaacag
cgcacgctggccggtcagcgcaggctggcgtcggcgatcgccggcgggcggccgatgtac
gagcgccccgacggccgccggttcagccacgacgagcccgagaagcgccaggaggcggcg
atgctgctcgacgcggcatcccggctcggcgacggcgacgtctacgtgcgatga

DBGET integrated database retrieval system