KEGG   Mycobacterium sp. KMS: Mkms_3791Help
Entry
Mkms_3791         CDS       T00442                                 

Definition
(GenBank) aldehyde dehydrogenase
Organism
mkm  Mycobacterium sp. KMS
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Aldedh
Motif
Other DBs
NCBI-ProteinID: ABL92984
UniProt: A1UJH6
LinkDB All DBs
Position
4004947..4006428
Genome map
AA seq 493 aa AA seqDB search
MRGDELFIGGTWCAPSTDRRIEVISPHTETTVGHVAAAAPADVDRAVGAAREAFDTGGWP
RTSPAGRIDAVRRLAANYERRRSEMAELITSEIGAPISFSQRAQVALPWSMINAFCDLAQ
TYPWREARPGRYGSDIQVLREPVGVVGAVVPWNMPQFLIVTKLIPALLAGCTVVVKPAPE
SPLNALLLAEVIAESGLPPGVVSVLPGDGSVGEYLVGHRGVDKVSFTGSTAAGRAVATAC
AADLRRVSLELGGKSAAIVLDDADPVVVAAGVRSASLSNSGQICNALTRVLVPRSRAGEF
TDALAAEVSALVVGDPTDGATQVGPLVARRQQQRVTGYLEQGVRDGARVVTGGTGMPDGL
DRGWYVKPTVFDRADNSMTIAREEIFGPVLTVVAYDNEDEAVAIANDSDYGLAGSVFTAD
TDRGLAVGAAIRTGTFGVNQGYTMDPFAPFGGVKSSGYGRELGREGIDGYVDTKSISVAP
KQDLATAAAGKGA
NT seq 1482 nt NT seq  +upstreamnt  +downstreamnt
gtgcgtggcgacgagttgttcatcggcggcacctggtgtgcaccgagcaccgaccggcgg
atcgaggtcatctccccgcacaccgagacgaccgtcggccacgtcgccgccgccgcaccc
gccgacgtcgaccgggccgtgggcgccgcccgggaagcgttcgacaccggcgggtggccg
cggacgtcgccggcaggccggatcgatgcggtgcgccggctcgccgcgaactacgaacgg
cgccgctccgagatggccgagctcatcacctccgagatcggcgcgccgatcagcttctcg
cagcgggcccaggtggcactgccgtggtcgatgatcaacgccttctgcgatctggcgcag
acgtatccgtggcgagaggcccgccccggtaggtacggctccgacatccaggtgctgcgt
gagccggtcggcgtcgtcggcgcggtcgtgccgtggaacatgcctcagttcctcatcgtc
accaagctgatcccggcgctgctggcggggtgcaccgtcgtcgtcaagcccgctcccgag
tcaccgttgaacgctctactgctcgccgaggtcatcgccgagtccggcttgccgccgggc
gtggtcagcgtgctgcccggcgacgggagcgtcggcgagtacctggtgggccatcgcggc
gtggacaaggtgtcgttcaccgggtcgacggccgcaggccgggccgtcgccaccgcatgc
gcggccgacctgcggcgggtcagcctcgaactggggggcaagtcggcggccatcgtcctc
gacgacgccgatcccgttgtggtcgccgcgggcgtgcggtcggcgagcctgtccaacagc
ggtcagatctgcaatgcgctcacccgcgttctcgtccccaggtcccgcgccggggagttc
accgatgcgttggccgcggaggtcagcgcgctggtcgtcggcgaccccaccgacggtgcc
acccaggtcggcccgctcgtggccagacggcaacagcagcgggtcaccggctacctcgag
cagggtgtgcgggacggcgcgcgggtggtcaccggtggcacgggcatgcccgacggactc
gaccgcgggtggtacgtcaagcccaccgtcttcgaccgggcggacaactcgatgacgatt
gcgcgcgaggagatcttcgggcccgtgctgacggtcgtcgcctacgacaacgaggacgag
gcggttgccatcgccaacgactccgactacggcctggctggatcggtgttcactgcggac
accgacagagggctggccgtcggcgcggcgatccgcaccggcaccttcggcgtcaaccag
ggctacacgatggatccgttcgccccgttcggtggcgtgaagtccagcggctacgggcgt
gagctcggccgagaaggcatcgacgggtacgtcgacaccaagtcgatctccgttgcgccg
aaacaggatctcgccacggcggccgcgggcaagggagcgtga

DBGET integrated database retrieval system