KEGG   Mycobacterium sp. KMS: Mkms_5005Help
Entry
Mkms_5005         CDS       T00442                                 

Definition
(GenBank) ATP dependent DNA ligase
Organism
mkm  Mycobacterium sp. KMS
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DNA_ligase_A_M DNA_ligase_A_C
Motif
Other DBs
NCBI-ProteinID: ABL94194
UniProt: A1UMY6
LinkDB All DBs
Position
complement(5245129..5246190)
Genome map
AA seq 353 aa AA seqDB search
MDTMDLPVMPPLEPMLAKAQAKVPTESGVWSYEPKWDGFRALVFRDGDDVVLMSRSGKDL
ARYFPEVLDFVRDELAPRCVLDGEIVVPREIGGRTRLDWESLSQRIHPAESRVRKLSEET
PAHFIGFDALASGDTSLMKEPFRARRQALIEAVSHKQWCHVTRTTEDPGLGAQWLEEFEG
AGLDGVIAKRLDGSYLPGKREMVKVKHARDADCVAIGYRIHKSGEGIGSLLLGLYTDEGD
LQMVGGAASFTAKDRLKLLAELEPLREGDEVREGDPSRWNSAADKRWIPIRPERVAEVAY
DQMEGNSVQGRRFRHAVKFRRWRPDRDPASCTFDQLEVPLTYDLFDVLETQDG
NT seq 1062 nt NT seq  +upstreamnt  +downstreamnt
atggacaccatggacctacccgtcatgccgccgctggagccgatgctcgccaaagcccag
gcgaaggtgccgaccgaatccggcgtctggtcctacgaaccgaaatgggacggcttccgc
gcactggtgttccgcgacggtgacgacgtcgtgctgatgtccaggagcggcaaggacctg
gcgcggtacttccccgaggtgctcgacttcgtgcgcgacgaactggccccgcgctgtgtg
ctcgacggcgagatcgtcgtcccccgtgagatcggcggtcgcacccggctggactgggag
tcgctgagccagcgcatccatcccgccgaatcgcgcgtgcgcaagctctccgaggagacc
cccgcgcatttcatcggtttcgacgcactcgccagcggtgacacctcgctgatgaaggag
ccgttccgcgcccggcgtcaggcgctcatcgaggctgtctcgcacaagcagtggtgtcat
gtcacgcggaccacggaggaccccgggctcggtgcgcagtggctcgaggagttcgagggt
gccggtctcgacggtgtgatcgccaaacgcctcgacggctcgtacctgccgggtaagcgg
gagatggtcaaggtcaaacacgcccgcgacgccgactgcgtggccatcggctaccggatc
cacaagagcggggaggggatcggctcgctgctgctcggactgtacaccgacgagggcgac
ctccagatggtcggcggggcagcgtctttcactgccaaggaccggctcaagctgctcgcc
gaactcgaaccgctgcgtgagggggacgaggtgcgggagggcgatccgagccgttggaac
tccgcggcggacaagcgctggataccgatccggccggagcgggtcgcggaggtggcctat
gaccagatggagggaaactcggtgcaggggcggagattccgacatgcggtcaagttccgg
cgatggcggccggaccgcgatccggccagttgcacgttcgaccaactggaagttccgctg
acctacgacctcttcgacgtgttggagacccaggatggctag

DBGET integrated database retrieval system