KEGG   Mycobacterium kansasii ATCC 12478: MKAN_05790Help
Entry
MKAN_05790        CDS       T02887                                 

Definition
(GenBank) aldehyde dehydrogenase
Organism
mkn  Mycobacterium kansasii ATCC 12478
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Aldedh
Motif
Other DBs
NCBI-ProteinID: AGZ49842
UniProt: U5WLK1
LinkDB All DBs
Position
1305330..1306820
Genome map
AA seq 496 aa AA seqDB search
MTAESPQHRYDELFIGGRWRKPTTPERLSVISPHSEQPVGEAPAAGPGDVEAAVAAARHA
FDHGPWPLLDPHERMSKIEQLAAIYTRHLGDMADLITAEMGSPRSFSRLGQAAGAASMIH
LALAAARDFPWAERRQGVLGEAHVRRAPVGVVGAIVPWNVPQCLIMPKLIPALIAGCTVI
VKPAPETPLDALWLAEMIEQIELPEGVVSILTGGPAVGEALVRHPGVDKIAFTGSSTIGR
RIAGICGEQLKRVSLELGGKSAAIILDDADLDKTVAGLKTAGLMNNGQACVAQTRILVSE
RRHDEVVDALADMMAALHVGDPADEKTDIGPLVARRQQLRVQDYIRSGRQQGACIVVGGD
DSPADRGWYVRPTLFTGATNDMRIAREEIFGPVLTVLTYRDEEHAIRIANDSDYGLAGSV
WTADTAHGLEIAARIRTGTYGINMYMLDISTPFGGFKKSGIGREFGPEGLAEYAELQSVL
CNGKMPPLNVIAAAAG
NT seq 1491 nt NT seq  +upstreamnt  +downstreamnt
atgacggcagaatccccgcaacaccgctatgacgaactgttcatcggcgggcgctggcgc
aaacccaccacgccggagcggctttccgtcatttcgccgcactcggagcaacccgtgggc
gaagcaccggcggctggtcccggcgatgtcgaggcggccgtggcagccgcgcggcacgcg
ttcgaccacggtccgtggccgctgctggatccgcacgagcggatgagcaagatcgagcag
ctcgccgcgatttacacgcgacacctcggcgacatggccgacctgattaccgcggagatg
gggtcgccgcgcagcttcagccggctgggccaggcggctggtgcggcgtcgatgatccat
ctggcgctggcggccgcccgggacttcccgtgggcggaacgccggcagggcgtgctcggc
gaggcccatgtgcgtcgtgcccccgtcggcgtcgtcggcgccattgtgccgtggaacgtg
ccacagtgcctgatcatgcccaagctgattccggcgctgatcgccggctgcaccgtcatc
gtcaaacccgcgcccgaaactcctttggacgctttgtggttggccgagatgatcgagcag
atcgaactgcccgagggcgtcgtctcgatactgaccggcggacccgctgtcggcgaggcg
ctggtgcgccatcccggggtggacaagatcgcgttcaccggctccagcaccatcggccgc
cggatcgccggaatctgcggagagcagctgaaaagggtcagcctggaactgggcggcaag
tcggcggcaatcatcctcgacgacgccgacctcgacaagacggtcgccggattgaagacg
gccggcctgatgaacaacggccaggcctgtgtcgcccagacccgcatcctggtcagcgaa
cgccgtcacgacgaagtcgtcgacgccttggccgacatgatggcggcgctgcacgtcggc
gaccccgctgacgaaaagaccgacatcgggccacttgtcgcccgccgccaacagcttcgg
gttcaggactacatcagatccgggcggcagcagggcgcgtgcatcgtggtcggcggtgac
gacagcccggccgaccgtggttggtacgtgcggccgacgctgttcaccggcgcgaccaat
gacatgcgcatcgcgcgggaggagatattcggaccggtgttgaccgttctgacctaccgt
gacgaagagcacgcgatccggatcgccaacgacagcgattacggcttggccggttcggtc
tggacagccgacaccgcccacggcctcgaaatcgccgcacggatccggaccggcacctac
ggcatcaacatgtacatgctcgacatcagcacaccgttcggcggcttcaagaagtcgggc
atcggccgcgaattcgggccagagggcctagccgaatacgccgagctgcaatcggtgctg
tgcaacggaaaaatgccaccgctcaatgtcattgcggcagctgcagggtga

DBGET integrated database retrieval system