KEGG   Mycobacterium kansasii ATCC 12478: MKAN_09095Help
Entry
MKAN_09095        CDS       T02887                                 

Definition
(GenBank) ATP-dependent DNA ligase
  KO
K01971  bifunctional non-homologous end joining protein LigD [EC:6.5.1.1]
Organism
mkn  Mycobacterium kansasii ATCC 12478
Pathway
mkn03450  Non-homologous end-joining
Brite
KEGG Orthology (KO) [BR:mkn00001]
 09120 Genetic Information Processing
  09124 Replication and repair
   03450 Non-homologous end-joining
    MKAN_09095
Enzymes [BR:mkn01000]
 6. Ligases
  6.5  Forming phosphoric-ester bonds
   6.5.1  Ligases that form phosphoric-ester bonds (only sub-subclass identified to date)
    6.5.1.1  DNA ligase (ATP)
     MKAN_09095
DNA repair and recombination proteins [BR:mkn03400]
 Prokaryotic Type
  DSBR (double strand breaks repair)
   NHEJ (non-homologous end-joining)
    Two-component NHEJ DNA repair complex
     MKAN_09095
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: LigD_N DNA_ligase_A_M DNA_ligase_A_C RNA_ligase DNA_primase_S
Motif
Other DBs
NCBI-ProteinID: AGZ50419
UniProt: U5WMM9
LinkDB All DBs
Position
complement(2054452..2056803)
Genome map
AA seq 783 aa AA seqDB search
MGSAQVWPPGGEDGPRVTLTNADKVLYPATGTTKRDVFDYYTRIAEVMVPHIAGRPATRK
RWPNGVDQPSFFEKQLASSAPDWLPRASVVHRSGTTTYPIIDSATGLAWIAQQAALEVHV
PQWRFVAEWTRSEAEQLKPGPATRLVFDLDPGDGVTMAQLVEVAHAVRELISGIGLSTFP
LTSGSKGLHLYAPLDEPVSSRGATVLAKRVAQQLEKTMPTLVTAIMTKSLRAGKVFLDWS
QNNGSKTTIAPYSLRGRDQPTVAAPRTWDELHDPGLRQLRYDEVLVRVARDGDLLAPLDA
DLPAGDRLTKYRSMRDASKTPEPVPRSRPVVGQGNTFVIQEHHARRLHYDFRLERDGVLV
SWAVPKNLPETASVNHLAVRTEDHPLEYATFEGTIPKGEYGAGKVIIWDAGTYDVEKFRD
GAESAAEKGPQKGPQKGPRKGEVIVNLHGKRISGRYALIQTNGDQWLAHRMKEQQAFDFD
TLAPMLTTHGSVDRLKAGQWAFEGKWDGYRLLVEADHGAVRLRSRSGRDVTKEYPQLRSL
AADLADHHVVLDGEVVALDAAGVPSFNEMQNRVRATRIEFWAFDLLYLDGRSLLRAKYQD
RRKLLETLGAAGHLTVPELLPGDGAEAMAYSRKRGWEGVIAKRRDSGYQPGRRSAAWIKD
KHWNTQEVVIGGWRAGEGGRSSGIGSLLMGIPGPSGLHFAGRVGTGFTQRNLDSLKRTLA
PLRTDENPFGASLPAREAKGVTFVEPTLVGEVRYSEWTPDNRLRQTSWRGLRPDKDPSEV
VRE
NT seq 2352 nt NT seq  +upstreamnt  +downstreamnt
atgggttcggcgcaggtgtggcctccgggcggggaggatggtccgcgggtcacgctgacc
aacgccgacaaggtgctctatccggcgaccgggaccaccaagcgcgacgtcttcgactac
tacacccgcatcgccgaggtgatggtgccgcatatcgccgggcgtccggcgacccgcaag
cgctggcccaacggagtcgaccaaccttccttcttcgaaaaacaactggcgtcgtcagcg
ccggactggttgccgcgggcaagcgtcgtgcaccggtccggaaccacgacctatccgatc
atcgacagcgcgacggggctggcgtggatagcccagcaggcggcgctcgaggtgcatgtg
ccgcagtggcggtttgtcgccgaatggacacgaagcgaggcggagcagttgaagcccggc
ccggctacccgattggtgttcgacctggacccgggtgacggcgtgacgatggcccagctg
gtcgaggtcgcacatgcggtccgggagctgatcagcggtatcgggctgagcaccttcccg
ctgaccagcggcagcaagggtctgcatctgtacgcaccactggacgagccggtgagcagc
agaggcgccacggtgctggccaaacgcgttgcgcaacaactggagaagacgatgcccacg
ctggtcaccgcgatcatgaccaagagcctgcgggcgggcaaggtgtttttggactggagc
cagaacaacgggtccaagaccaccatcgcgccgtactcgctacgcgggcgcgaccagccg
acggtcgccgcgccccgcacctgggacgaactgcacgacccggggctgcgccagctgcgc
tatgacgaggtgctggtccgggtcgcccgcgacggggacctgctcgcgccgctggatgcc
gacctgcccgccggggaccggctgaccaagtaccgcagcatgcgcgacgcgtcgaagacc
cccgaaccggttcctcggtccagacctgttgtcggccaaggcaatacctttgtcatccag
gagcaccacgcccgccggctgcactacgacttccggttggagcgtgacggcgtgctggtg
tcgtgggcggtgccgaagaacctgccggaaaccgcatcggtgaaccatcttgcggtgcgc
accgaagatcatccgctggaatatgcgacattcgagggcacgatcccgaagggggagtac
ggcgccgggaaggtgatcatctgggacgccggcacgtacgacgtcgagaagttccgcgac
ggggccgaaagcgcggccgaaaaaggaccccaaaaaggaccccaaaaaggaccccgaaaa
ggagaagtgatcgtcaacctgcatggcaagcgaatctccgggcggtacgcgctgatccaa
accaacggtgaccagtggctggcgcatcgcatgaaggaacagcaggccttcgacttcgac
accctggctccgatgctcaccacacacggttcggtggaccgtctcaaggcgggacagtgg
gccttcgaaggcaagtgggacggctaccggttgctggtggaggccgaccacggcgccgtg
cggctgcgctcccgtagtggccgtgacgtcaccaaagaatatccgcaattgcgttcgctg
gcagcagacctcgccgatcaccacgtggtgctcgacggggaggtggtcgcactcgacgcc
gccggcgtgcccagcttcaacgaaatgcagaaccgggtccgggccacccgcatcgagttc
tgggcattcgacctgctctacctcgacggccgctcgctgttgcgtgccaagtaccaggac
cggcgcaagctgctggaaaccctgggcgccgcaggccatctcactgttccggagctgctg
cccggtgacggagccgaggccatggcttactcgcgcaaacgcggctgggagggtgtgatc
gccaagcggcgtgattccggttatcagcccggccggcgttcggcagcgtggatcaaggac
aagcactggaacacccaggaggtcgtcatcggcggctggcgggccggggagggcggtcgc
agcagcggcatcggctcgctgctgatgggcattcccggcccttccgggctgcatttcgcc
ggccgagtcggaacgggcttcacccaacgcaacctggacagcctgaaaaggacgctggcg
cccttgcgcaccgacgaaaatcctttcggcgcttcgcttccggcgcgtgaggctaagggc
gtcacgttcgtcgagccgacgctggtcggcgaggtgcgctatagcgaatggacccccgac
aatcggctgcgtcaaacgagttggcgtgggctgcggccggacaaggacccgagtgaggtg
gtgcgggaatga

DBGET integrated database retrieval system