KEGG   Mycobacterium kansasii ATCC 12478: MKAN_13625Help
Entry
MKAN_13625        CDS       T02887                                 

Gene name
ligC
Definition
(GenBank) ATP-dependent DNA ligase
Organism
mkn  Mycobacterium kansasii ATCC 12478
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DNA_ligase_A_M DNA_ligase_A_C
Motif
Other DBs
NCBI-ProteinID: AGZ51188
UniProt: U5WPP9
LinkDB All DBs
Position
2981879..2982994
Genome map
AA seq 371 aa AA seqDB search
MDLPVMPPVSPMLAKSVKTIPADASYEPKWDGFRSICFRDGDEVELGSRNERPMTRYFPE
LVAAIKAELPARCVVDGEIVIATDHGLDFEALQQRIHPADSRVRMLAEHTPASFIAFDLL
ALGDDDYTTRPFSERRAALVDALTVSGAVSGAASGPSIHVTPATTDLATAQRWFDEFEGA
GLDGVIAKPLTITYQPDKRVMFKIKHERTADCVVAGYRVHKSSGPEDGAVGSLLLGLYQQ
DGQLASVGVIGAFPMAQRRRLFDELQPLVTTFDNHPWNWAAHEAGERTPRKNEFSRWNAG
KDLSFVPLRPERVVEVRYDHMEGARFRHTAQFNRWRPDRDPRSCTYAQLEQPVSFHLDDI
VAGLGPGRGDG
NT seq 1116 nt NT seq  +upstreamnt  +downstreamnt
atggacctgcccgtcatgccgcccgtttcgccgatgctggccaaatccgtcaagaccatt
ccggcggacgcgtcgtacgagccgaaatgggacggcttccggtccatctgttttcgcgac
ggcgacgaggtcgagctgggcagccgcaacgagcggccgatgacccgctacttccccgaa
ctggtcgcggcaatcaaggccgaactgccggcgcgctgcgtcgtcgacggcgaaatcgtc
atcgccaccgaccacggcctggacttcgaggcgctgcaacagcgcatccacccggccgat
tcgcgggtacgcatgctcgccgagcacacgccggcgtcgttcatcgcgttcgacctgctg
gctctcggtgacgacgactacaccacccgtccgttcagcgagcgccgggcggcgctggtc
gacgcgttaactgtttcgggagctgtttcgggagccgcttcgggcccgtcgattcacgtc
accccggccaccaccgacctggcaaccgcgcagcgctggttcgacgagttcgagggcgcg
ggtctcgacggcgtcatcgccaagccgctcaccatcacctaccagcccgacaagcgcgtc
atgttcaagatcaaacatgaacggaccgccgactgcgtggtggccggttaccgggtgcac
aagtccagcggcccggaagatggggcggtcggctcgctgttgctggggctctaccagcag
gacggccaactcgcttcggtgggtgtgatcggagccttcccgatggcgcagcgacggcgg
ctcttcgacgaattacagccgctggtaacgactttcgacaaccacccctggaactgggcg
gcccacgaagccggcgaacgcaccccgcgcaagaacgaattctcccgctggaacgccggc
aaagacctgtccttcgtgccgctgcggccggagcgggtcgtcgaagtccgctacgaccac
atggaaggcgcgcggtttcgccacaccgcccagttcaaccggtggcggcccgaccgcgat
ccacgctcgtgcacctacgcccaactcgagcagccggtgtcgttccacctggacgacatt
gtcgccggcctcggacctggccgaggcgacggctag

DBGET integrated database retrieval system