KEGG   Mycobacterium kansasii ATCC 12478: MKAN_15925Help
Entry
MKAN_15925        CDS       T02887                                 

Gene name
katE
Definition
(GenBank) hydroperoxidase II
  KO
K03781  catalase [EC:1.11.1.6]
Organism
mkn  Mycobacterium kansasii ATCC 12478
Pathway
mkn00380  Tryptophan metabolism
mkn00630  Glyoxylate and dicarboxylate metabolism
mkn01110  Biosynthesis of secondary metabolites
mkn01130  Biosynthesis of antibiotics
mkn01200  Carbon metabolism
Brite
KEGG Orthology (KO) [BR:mkn00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00630 Glyoxylate and dicarboxylate metabolism
    MKAN_15925 (katE)
  09105 Amino acid metabolism
   00380 Tryptophan metabolism
    MKAN_15925 (katE)
Enzymes [BR:mkn01000]
 1. Oxidoreductases
  1.11  Acting on a peroxide as acceptor
   1.11.1  Peroxidases
    1.11.1.6  catalase
     MKAN_15925 (katE)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Catalase Catalase-rel DJ-1_PfpI
Motif
Other DBs
NCBI-ProteinID: AGZ51586
UniProt: U5WUL2
LinkDB All DBs
Position
3473534..3475645
Genome map
AA seq 703 aa AA seqDB search
MAANDSNPKQRQLDDCRLDGSTGYLTTQQGVRVDHTDDALTAGERGPTLLEDFHAREKIT
HFDHERIPERVVHARGAGAYGYFEPYDDWLAEYTAAKFLTTPGKQTPVFVRFSTVVGSRG
SADTVRDVRGFATKFYTDQGNYDLVGNNFPVFFIQDGIKFPDLVHAVKPEPHNEIPQAQS
AHDTLWDFVSLQPETLHTIMWLMSDRALPRSYRMMEGFGVHTFRLVNADGQGTFVKFHWK
PRLGVHSLVWEECQKVAGKDPDFNRRDLWEAIEAGQYPEWEFGVQLVPESDEFNFGFDLL
DATKIIPEEQVPVRPVGKMVLNRNPDNFFAETEQVAFHTANVVPGIDFTNDPLLQFRNFS
YLDTQLIRLGGPNFAQLPVNRPVAEVHNNQRDGYGQHTIPRGRSSYYNNSLGGGCPALAD
DNVFRHYTQKVDGHKIRQRAESFQDHYSQARMFWKSMSAVEAKHIVAAYAFELGKVETPE
IRSRVVDQLNRVDHDLATRVAGELGLPAPEGTDKLGAEMPPSPALSQLNTATDSVETRKI
AVLAADGVDVVGTQTFIEAMRQRGAIVEVLAPRAGGMLSGGSGGELPVDRAITTMSSVLY
DAVVIPCGPDAVKALSEDGYVMHFVTEAYKHLKAVGAFGAGVKLLPKAGITEKTAESTDA
FVSNGVITTKAAADDLSDDFAEAFAKVLAKHRVWERQTDSVPA
NT seq 2112 nt NT seq  +upstreamnt  +downstreamnt
atggcagccaacgactccaacccgaagcaacgacagcttgacgactgccggctagacggg
agcaccggatacctgaccacgcagcagggcgtgcgagtggaccataccgacgatgcactt
accgcgggggagcgtgggcccaccctgctcgaggacttccatgcccgggaaaagatcacc
cacttcgatcacgagcgcatccccgaacgagtggtacacgcccgcggggccggagcatac
ggatacttcgagccctatgacgattggcttgccgaatacaccgcggcgaaattcctcacc
acgccgggtaagcagacgccggtcttcgtccggttttccaccgtcgtgggatctcgcggc
tcggcggacaccgtgcgcgatgtccgcggattcgccaccaagttctacaccgaccagggc
aactacgacctggtgggcaacaacttcccggtgttcttcatccaggacggcatcaagttc
ccggatttggtgcacgcggttaaacccgagccacacaacgagattccgcaggcgcagtcg
gcccacgacacgctgtgggacttcgtgtcgctgcagccggagacgctgcacaccatcatg
tggctgatgtcggaccgggcgctgccgcgcagttaccgaatgatggagggcttcggcgtg
cacaccttccgcctggtcaacgccgacggccagggcactttcgtgaagtttcattggaag
ccacgccttggcgtgcattcgctggtgtgggaggagtgccagaaggtggccggcaaggac
cccgacttcaaccggcgcgacctgtgggaagccatcgaggccggccaatatccggagtgg
gagttcggggtgcagctggttccggaaagcgacgagttcaacttcggcttcgacctgctc
gacgccaccaaaatcattccggaggaacaggttccggtacgtccggtgggcaagatggtg
ctcaaccgcaacccggacaacttcttcgccgaaaccgagcaggtggcgttccacaccgcc
aacgtggtgcccggcatcgacttcaccaacgacccactgctgcagttccgcaacttctcc
tacctcgacacccagctgatcaggttgggcggccccaatttcgcgcaactgccggtcaat
cggccggtggccgaggtgcacaacaaccagcgcgacggctacggccagcacaccattcca
cgcggccggtcaagctactacaacaacagccttggcggcggctgtccggccctggcagac
gacaacgtgttccgccactacacccagaaggtcgacggtcacaagatccgccagcgggcc
gaaagcttccaggatcactacagccaggcccggatgttctggaagagcatgtctgccgtc
gaggccaaacacattgtcgccgcgtacgccttcgagctcggcaaggtggaaacaccggaa
atccgttcgcgcgtcgtggatcagctgaaccgcgtcgaccatgacctggcgacccgcgtc
gccggggagctggggctgcccgcgcccgaaggaacggacaagctgggcgccgaaatgccc
ccctccccggcgctttcgcaactcaataccgccaccgacagcgtcgaaacacgcaagatc
gccgtgctggccgccgacggcgtcgacgtggtgggcacccagaccttcatcgaggcgatg
cggcagcgcggggccatcgtagaagtgttggcgcccagggccggtggcatgctgtccggc
ggatccggcggcgaactcccggtggaccgggcgatcaccacgatgtcgtcggtcctctac
gacgcggtcgtgataccgtgcggacccgacgccgtcaaggccctgtccgaagacggctac
gtgatgcatttcgtcaccgaggcctacaaacacctcaaggcggtgggggctttcggtgcg
ggcgtcaagttactgcccaaggccgggataaccgagaaaaccgccgagagcaccgacgcc
ttcgtctccaacggggtgatcacgaccaaggctgcggccgacgacctatccgacgacttc
gccgaggcattcgccaaagtgcttgccaaacaccgtgtttgggagcgacagaccgatagc
gtgcccgcctga

DBGET integrated database retrieval system