KEGG   Mycobacterium kansasii ATCC 12478: MKAN_16565Help
Entry
MKAN_16565        CDS       T02887                                 

Definition
(GenBank) acyl-CoA synthetase
Organism
mkn  Mycobacterium kansasii ATCC 12478
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: AMP-binding AMP-binding_C PAC2 DUF5111 FeoA
Motif
Other DBs
NCBI-ProteinID: AGZ51705
UniProt: U5WUH7
LinkDB All DBs
Position
3619060..3620589
Genome map
AA seq 509 aa AA seqDB search
MQIRQHLRDETSANKPAVILHPSGTVVTFAELEARANRLAHRFREAGLREGDVVAILMEN
NEHIHAVMWAARRSGLYYVPINTHLAPAEAAYIVDNSSARAIVGSAALRETCAGLAGHLP
GGLPELLMVADGDLAGWGRYPECVAGQPGTPIDDELEGDLLQYSSGTTGRPKGIKRELPH
VPPDQAPGMMSALIDYWMDRDSVYLSPAPLYHTAPSVWSMSAQAGGITTVVMEKFDPESA
LDAIQRYRVTHGQFVPAMFTRMLKLPDRVRNSYDISSLKRVMHAAAPCPVEIKKQMMDWW
GPIVDEYYASSEAIGSTLITAEDWLAHPGSVGKPMQGAVHILDPDGNELPPGQPGEIFFE
GGYSFEYLNDPSKTAASRDKHGWVTVGDIGYLDDEGYLYLTDRRHHMIISGGVNIYPQET
ENVLVTHPKVLDAAVFGVPDEEMGQRVMAAVQTVDPADATEEFAAELLAWLRNRLSHFKC
PKAIAFEVQLPRTDTGKLYKDGLIEKYSA
NT seq 1530 nt NT seq  +upstreamnt  +downstreamnt
atgcagatccgccagcacctgcgcgatgagacaagcgccaacaaaccggcagtcatcctg
catccgtccgggaccgtcgtcaccttcgcagagctggaagcccgagccaatcgactggcg
caccgattccgtgaggcggggctgcgggaaggcgacgtcgtcgccattctgatggaaaac
aacgagcacatccacgcggtcatgtgggcggcacgccgcagcggcttgtactacgtgccg
atcaacacccacctggccccggcagaggcggcctacatcgtcgacaacagtagcgccagg
gcgattgtcggctccgcggcgctgcgcgagacctgcgcgggtctggccggccaccttccc
ggaggcctgccggagctgctgatggtcgccgacggcgacctggcgggctgggggcgatac
ccggaatgcgttgccggccaacccgggacaccgatcgatgacgaactggaaggcgacctg
ctgcagtactcctcgggaaccaccggccggcccaagggaatcaaacgcgaattaccgcat
gtcccgccggatcaggcgcccgggatgatgtcggcgctcattgattattggatggaccgc
gattcggtgtacctgagcccggcgccgctctaccataccgcaccgtcggtgtggtcgatg
agcgcccaggccggcggcatcaccaccgtggtgatggagaagttcgatcccgagtcggcg
ctcgacgccattcagcgctaccgggtgacacacggccagttcgtcccggcgatgttcacc
cggatgctgaaactacctgatcgggtgcgtaattcgtacgacatatccagcctgaagcgg
gtgatgcacgccgcggcaccgtgtccggtcgagatcaagaagcagatgatggactggtgg
ggaccgatcgtcgacgagtactacgcgtcctccgaagccatcgggtccacgctgatcacc
gccgaggattggctggcgcaccccggttcggtcggcaagccgatgcagggcgcggtgcat
atcctggaccccgacggcaacgagctgccgccaggccagccgggtgagatctttttcgag
ggcggctactccttcgaatacctcaacgatccgtcgaaaaccgctgcgtcgcgcgataag
cacgggtgggtgacggttggcgacataggctatctcgacgacgagggctacctgtatctg
accgaccggcgccaccacatgatcatctccggcggcgtcaacatctacccgcaggaaacc
gaaaacgtgttggtcacccacccgaaggtgctcgacgcagcggttttcggtgttcccgac
gaggagatgggacagcgggtgatggcggcggtgcagaccgtcgacccggcggacgccacc
gaggaattcgctgctgaactgctggcgtggttgcggaatcgcctgtcgcacttcaaatgt
cccaaggccatcgctttcgaggtgcagttgccgcgcaccgacaccggcaagctctacaag
gacgggctgatcgagaagtattcggcctga

DBGET integrated database retrieval system