KEGG   Mycobacterium kansasii ATCC 12478: MKAN_16580Help
Entry
MKAN_16580        CDS       T02887                                 

Definition
(GenBank) acyl-CoA dehydrogenase
Organism
mkn  Mycobacterium kansasii ATCC 12478
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Acyl-CoA_dh_1 Acyl-CoA_dh_N Acyl-CoA_dh_M Acyl-CoA_dh_2
Motif
Other DBs
NCBI-ProteinID: AGZ51708
UniProt: U5WR72
LinkDB All DBs
Position
complement(3622074..3623240)
Genome map
AA seq 388 aa AA seqDB search
MTRVSNELNHEEAMLVDTVRAFIDRDVKPSVREVEHANAYPEAWIEQMKRIGIFGLAVSE
EYGGSPVSMPCYVQVTQELARGWMSLAGAMGGHTVVAKLLTLFGTEEQKTAYLPAMATGE
LRATMALTEPGGGSDLQSMSTTALVSEAGGLRINGAKTWITNARRSGLIALLCKTDPAAR
PRHKGISIVLVQPGPGLTVSRDLPKLGYKGVESCELSFDDYRVPVSAVLGSRMGEGFSQM
MKGLETGRIQVAARALGVATAALEDALAYAQQRESFGQPIWKHQAVGNYLADMATKLTAA
RQLTRYAAERYDSGQRCDMEAGMAKLFASEVAMEIALNAVRIHGGYGYSTEYDVERYFRD
APLMIVGEGTNEIQRNVIAGQLVARGGI
NT seq 1167 nt NT seq  +upstreamnt  +downstreamnt
atgacacgggtgagcaatgagctgaatcatgaagaagcgatgctggtcgacaccgtgcgg
gccttcatcgaccgtgacgtgaaaccgagcgtccgcgaggtggagcatgccaacgcctac
cccgaggcgtggatcgagcagatgaagcggatcggtatcttcggcctggccgtctccgaa
gagtacggcgggtcgccggtgtcgatgccgtgctatgtacaggtcacccaggagctggcg
cgcggctggatgagcctggcgggggcgatgggcgggcacaccgtggtggccaagctgctg
acgctgttcggcaccgaagaacagaagacggcgtatctgccggcgatggccaccggcgaa
ctgcgggccacgatggcactcaccgaacccggcggcggctccgacctgcagagcatgtcg
accaccgcgctggtatccgaagccggcggcttacggatcaacggcgccaagacctggatc
accaacgcgcgccgctccgggctgatcgcgttgctgtgcaagaccgatcccgctgcccga
ccacgccataagggaatctcgatcgtgctggtccagcccggaccgggcctgacggtgtcg
cgagacctgcccaagctgggctacaagggcgtcgagtcctgcgagttgtccttcgacgac
taccgggtgccggtgtcggcagtcttgggtagtcgcatgggggaaggcttttcgcagatg
atgaagggcctcgaaacaggccgcatccaagtggcggcccgtgccctgggggtggcaacc
gcggcactggaagacgcgctcgcctatgcccagcagcgggagagcttcggtcagccgatt
tggaagcatcaggccgtcggcaactatctggccgacatggcaaccaaactcaccgccgca
cgccaactgacccgctatgccgccgagcgctacgacagcggccagcgttgcgacatggag
gcagggatggccaagctgttcgcctccgaggtggcgatggagatcgcgttgaacgcggtg
cgcatccacggcggctacggctactcaacggaatacgacgtcgaacgctatttccgcgat
gcgcccctgatgatcgtcggtgaaggcaccaacgagatccagcgcaatgtgatcgccgga
caactggtggcccggggcggtatctag

DBGET integrated database retrieval system