KEGG   Mycobacterium kansasii ATCC 12478: MKAN_16605Help
Entry
MKAN_16605        CDS       T02887                                 

Definition
(GenBank) membrane protein
Organism
mkn  Mycobacterium kansasii ATCC 12478
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Oxidored_molyb Ni_hydr_CYTB DUF5337
Motif
Other DBs
NCBI-ProteinID: AGZ51713
UniProt: U5WR75
LinkDB All DBs
Position
3627960..3629378
Genome map
AA seq 472 aa AA seqDB search
MDSKGIGGRKQRRDTGGAAGSGADRRAADRQPGGPVGVPERQQDSAHGFPASLWRTVERH
PPPGADRLNRFRSPLRGPWLTSVFGLVLLVTLPIVVITGLLSYIAYAPQLGQAIPDDVGW
LRLPVFAWPTHPSWLYRLTQGVHVGLGLLIIPVVLAKLWSVIPKLFVWPPARSIAQLLER
VSLLMLVGGGLFEIVTGVLNIQYDYIFGFSFYTGHYFGAWVFIAGFLMHIALKVPRMITG
LRSLSMREVLRTNVTDTRPEPPDPDGLVAADPAAPTVSRRGALALVGSGVLLIAVLTVGQ
TLGGPARSAALLLPRGRGRDFPVNKTAAAAAIAPDSVGEKWRLTLRGGPAEVVLDRAALA
ALPQRTARLPIACVEGWSTVQTWTGVRLADLARIAGVPAPRSARVVSLQRGGAFGTARLQ
ANQINDPDALLALRVNGDDLPLDHGYPARIIVPALPGVHNTKWVAGIEFEPS
NT seq 1419 nt NT seq  +upstreamnt  +downstreamnt
gtggattcgaagggcatcggtgggcgtaaacagcgccgcgacactggcggcgcagccggg
tctggcgcggatcggcgggcggctgatcgccagcccggtggcccggtaggcgttccggag
cgacaacaagactcagcccacggctttcccgccagcctgtggcgcaccgtggagcgtcat
ccaccgccgggtgcggaccggctgaaccgctttcggagcccgttgcgcggcccgtggctg
acatcggtgttcggactggtgctgttggtgacgttgccgatcgtggtgatcaccgggttg
ctgtcctatatcgcctatgcaccgcagttgggtcaagcgatccccgacgacgtcgggtgg
ctgcggctgcccgtattcgcctggcccacccatccgtcgtggctgtaccggctgacccag
ggtgtccatgtggggctgggcctgctgatcatcccggtggtattggccaagctgtggtcg
gtgatcccgaaactgttcgtctggccgcccgcgcggtcgatcgcccagctgctggagcgg
gtgtcgttgttgatgctggtcggtggggggctgttcgagatcgtcaccggggtgctcaac
atccagtacgactacatcttcgggttcagcttctacaccgggcactatttcggggcgtgg
gttttcatcgccggcttcctgatgcatatcgcgctcaaggttccgcgcatgatcaccggg
ctgcgctcgctgtcgatgcgagaagtgctgcgcaccaacgtgaccgacacccggcccgaa
ccgccggatcccgacgggctggtggccgccgacccggcggcgccgacggtgagcaggcgt
ggcgccctggccctggtgggctccggtgtgctgctgatcgcggtgctgaccgtcgggcag
accctcggcgggccggcgcgcagcgcggcactgctcttgcctcgcggacgaggccgagat
ttcccggtcaacaagaccgccgcagccgccgcgatcgcacccgacagcgtcggcgagaag
tggcggctgacgctgcgcggcggtccggcggaggtggtactggatcgcgccgccctggcc
gcactgccgcagcgcaccgccaggctgccgatcgcctgcgtggaaggctggtcgaccgtg
cagacctggaccggggtccggctggccgacctggctcgaatcgccggggtcccggcacca
cgctcggcgcgagtggtatcgctgcagcgcggcggcgcattcggcaccgcgcggctgcag
gccaaccagatcaacgatcccgatgcgctacttgcactgcgcgtcaacggcgacgaccta
ccccttgatcatggctatccggcccgcatcatcgttcccgcgctgccgggtgtgcacaac
accaaatgggtcgcgggcatcgaattcgagccgagctga

DBGET integrated database retrieval system