KEGG   Mycobacterium kansasii ATCC 12478: MKAN_16610Help
Entry
MKAN_16610        CDS       T02887                                 

Definition
(GenBank) membrane protein
Organism
mkn  Mycobacterium kansasii ATCC 12478
SSDB OrthologParalogGene clusterGFIT
Other DBs
NCBI-ProteinID: AGZ51714
UniProt: U5WRD1
LinkDB All DBs
Position
3629380..3629919
Genome map
AA seq 179 aa AA seqDB search
MLRATKRFGHYYGAHPLHLLTMLSGFALLGYLLATFKPATLWNPGTWWQSIAVWFAAAVI
GHDLLLFPLYALADHVLAAPGRRSGRSQPELPEISARNHIRIPALGSGLTLLIFLPGIIE
QGAPTYLAATGQTQQPFLGRWLLLTAAMFAVSAIVYAARRAVGRRWGAGSPQRSSEPPQ
NT seq 540 nt NT seq  +upstreamnt  +downstreamnt
atgctaagagcgacaaagcggttcggccactactacggcgcgcatccactacacctgctc
accatgctgtccggcttcgcgctgctcggctacctcctggccaccttcaagcccgccaca
ctgtggaaccccggcacctggtggcagtcgatcgcggtctggttcgccgccgccgtgatc
ggacacgacctgctgctctttccgctatacgcgctggccgaccacgtcctggcggcgcct
gggcgtcggtcgggccgctctcagccagaactcccagagatcagcgcgcgcaaccacatt
cgcatcccggcgctgggatccgggctgaccctgctgatcttcctgcccggcatcatcgaa
cagggtgcaccgacctacctggcggcgaccggacagacccagcagccgtttctgggcaga
tggctgctgctgaccgcggcgatgttcgccgtcagcgccatcgtttacgctgcccggcgc
gccgttgggcggcgatggggcgccggcagcccacagcgcagcagcgaaccaccccaatga

DBGET integrated database retrieval system