KEGG   Mycobacterium kansasii ATCC 12478: MKAN_16615Help
Entry
MKAN_16615        CDS       T02887                                 

Definition
(GenBank) esterase
Organism
mkn  Mycobacterium kansasii ATCC 12478
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Abhydrolase_3 Peptidase_S9 COesterase Hydrolase_4 BAAT_C DLH Abhydrolase_4 Abhydrolase_1 Peptidase_S15
Motif
Other DBs
NCBI-ProteinID: AGZ51715
UniProt: U5WUJ0
LinkDB All DBs
Position
3629960..3631171
Genome map
AA seq 403 aa AA seqDB search
MTASGPIIPTMMSQVKWLLRARPGDYLLALSVAGASLPVVGKHLEPLGSVTAMSVWGARH
APEFVSTRAKDWLTPGTSGLRRRDRASTNEVSVAALRGIVATAELDLEWPVPQRTPPVCE
ALRHRRYLHRRGVHYGDSPAQLLDVWRRKELPTHPAPVLLFVPGGAWIHGSRTMQGYALL
SRMAEQGWVCLSIDYRVAPHHRWPRHIQDVKAAIAWARANVDKFGGDRDFIAIAGCSAGG
HLSALAGLTANDPGYQGELPEGSDTSVDAAVGIYGRYDWQDRSTPERVRFVDFLERVVVN
RRIARHPHVYRDASPIARVHNNAPPFLVIHGSRDGVIPVAQARSFVERLRAASRSLVAYV
ELPGAGHGFDLLDGARTGPTTHAISLFLNHVHRTRNQFAKEVI
NT seq 1212 nt NT seq  +upstreamnt  +downstreamnt
atgacggcgagcggcccgataatcccgacaatgatgtcccaggtcaaatggttgctgcgg
gcccgtccgggcgactatctgctggcattgagcgtcgccggggcttcgctcccggtggtc
ggcaagcacctcgagccgctgggcagtgtcaccgcgatgagcgtctggggtgcccggcat
gcaccggaattcgtgtccaccagggccaaggactggctcaccccgggaaccagcggcctc
cgccgtcgcgaccgcgccagtacgaacgaggtttcggtcgcggcgctgcggggcatcgtg
gcgaccgccgagctggacctcgaatggccggtgccgcagcgcaccccaccggtctgcgaa
gccctgcggcaccgccgctacctgcaccgccgtggcgtccattacggcgacagcccggcg
cagttgctcgacgtgtggcgccgcaaggagctgcccacccatcccgcgcccgtgttgctg
ttcgtcccgggcggcgcctggatacacggcagccgcaccatgcaggggtatgcactgctg
tcgcgcatggcggagcagggctgggtgtgcctgtcgatcgactaccgcgtcgcgccgcac
caccgctggccgcgccacatccaagacgtcaaggccgccatcgcctgggcgcgggccaac
gtcgacaaattcggcggcgaccgtgacttcatcgcgatagcgggctgctcggccggcggc
cacctgtccgcattggccgggctcaccgccaacgaccccggctaccagggcgagttaccg
gagggctccgacacctcggtcgacgccgcggtcggtatctacggtcgttacgactggcag
gaccgctccaccccggagcgggtgcggttcgtcgacttcttggagcgggtcgtggtcaat
cgcaggatcgcccgccacccgcacgtataccgggatgcatcgccgatagcccgggtgcac
aacaatgcgccgccgttcctggtcattcacggcagccgcgacggggtcatcccggtggcg
caggcgcgcagcttcgtcgagcggctacgtgcggcgtcgcggtcgctggtggcctatgtg
gaattgcccggggccggccacggcttcgatttgctcgacggcgctcgcaccggcccgacc
acccacgcgatctcgctattcctcaaccacgttcaccgcacccggaatcagttcgcaaaa
gaggtcatctag

DBGET integrated database retrieval system