KEGG   Mycobacterium kansasii ATCC 12478: MKAN_16620Help
Entry
MKAN_16620        CDS       T02887                                 

Definition
(GenBank) diacylglycerol O-acyltransferase
  KO
K00635  diacylglycerol O-acyltransferase / wax synthase [EC:2.3.1.20 2.3.1.75]
Organism
mkn  Mycobacterium kansasii ATCC 12478
Pathway
mkn00561  Glycerolipid metabolism
mkn01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:mkn00001]
 09100 Metabolism
  09103 Lipid metabolism
   00561 Glycerolipid metabolism
    MKAN_16620
Enzymes [BR:mkn01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.20  diacylglycerol O-acyltransferase
     MKAN_16620
    2.3.1.75  long-chain-alcohol O-fatty-acyltransferase
     MKAN_16620
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: WES_acyltransf DUF1298 Condensation
Motif
Other DBs
NCBI-ProteinID: AGZ51716
UniProt: U5WUY2
LinkDB All DBs
Position
3631224..3632633
Genome map
AA seq 469 aa AA seqDB search
MKRLSGWDAVLLYSETPNVHMHTIKVAVIELDPDSRQFGIDAFREVIGGRMGKLEPLGYQ
LIDIPLKFHHPMWREHCEVDLNYHIRPWRLPPPGGRRELDEAIGQIASTALDRRYPLWEM
YFVEGLANHRVAVVAKIHHALADGVASANLMARGMDLLPGPEGNPYVSDPAPSKRELMSS
AFVDHLRHLGRVPATMRYTAEGLARVRRSARKLSPELTRPFTPPPTFMNHKITPERRFAT
ATLALVDVKETGRRLGATINDMVLAMSTGALRSLLLRYDGTAEPLLASVPVSYDFSPQRI
SGNHFSGMLVALPTDCDDPLERVRGCRENALSAKESHQLLGPELISRWAAYFPPAGAEAM
FRWMSGRDGQNKILNLNISNVPGPRERGRVGGALVTEIYSVGPLTAGSGLNITVWSYVDQ
LNISVLTDGATLRDPHEVTEAMIADFIEIRRAAGLSEELTVVELALAQA
NT seq 1410 nt NT seq  +upstreamnt  +downstreamnt
gtgaaacggctcagcggctgggacgcggtattgctctacagtgagacaccgaatgtgcac
atgcacaccatcaaggtcgcggtgatcgagctggacccggacagccgccagttcggtatc
gacgcgtttcgcgaggtcatcggcgggcgcatgggcaagctggagccgttgggctatcaa
ctgatcgacatcccgctcaagttccaccatccgatgtggcgtgagcactgcgaggtcgat
ctcaactaccacatccggccctggaggctgcccccgccgggcggccgacgcgaattggac
gaggcgatcggtcagatcgccagcaccgcattggaccgcagatacccgctgtgggagatg
tatttcgttgagggccttgccaatcaccgggtggcagtggtcgccaagattcaccacgcg
ctggccgacggggtcgcttcggcaaacctgatggcgcgcggcatggatctgctgccggga
ccggaaggcaacccgtacgtgtcggacccggccccgagcaagcgggagctgatgagttcg
gcgttcgtcgaccacctgcgccacctggggcgggtccccgcgacaatgcggtataccgcg
gagggtctggcccgggtgcggcgcagcgcgcgcaagctctctcccgaattgacccggccg
ttcaccccgccgccgaccttcatgaaccacaagatcactccggagcgcaggttcgccacc
gccaccctggcgctggtcgatgtgaaggagacggggagaaggctcggggcgacgatcaac
gacatggtgctggccatgtccaccggagcgctgcgcagcctgctgctgcgctacgacggc
acggccgaaccgttgctcgcctccgtcccggtgagctacgacttctcaccgcagcggatc
tcgggaaaccacttcagcggcatgctggtggcgctgccgaccgactgtgacgacccgctg
gagcgggtgcggggctgtcgcgagaacgcgttgtccgccaaggaaagtcaccagctgctg
ggaccggaactgatcagccgctgggcggcctactttccaccggccggtgccgaggcgatg
tttcggtggatgtccggccgcgacgggcagaacaagatcctcaacctgaacatctcgaac
gttcccggtccgcgcgaacgcggcagggtgggtggtgcgctggtgaccgagatctattcg
gtgggcccgttgaccgcgggcagcggcctgaacatcaccgtgtggagctatgtcgaccaa
ctcaacatctcggtgctgaccgacggcgccaccctcagggatccacacgaggtgaccgag
gccatgatcgccgattttattgaaatacgaagggccgctggtctttccgaagagttgaca
gtcgtcgagctggcgctggcgcaagcgtga

DBGET integrated database retrieval system