KEGG   Mycobacterium kansasii ATCC 12478: MKAN_16665Help
Entry
MKAN_16665        CDS       T02887                                 

Definition
(GenBank) aldehyde dehydrogenase
  KO
K00128  aldehyde dehydrogenase (NAD+) [EC:1.2.1.3]
Organism
mkn  Mycobacterium kansasii ATCC 12478
Pathway
mkn00010  Glycolysis / Gluconeogenesis
mkn00053  Ascorbate and aldarate metabolism
mkn00071  Fatty acid degradation
mkn00280  Valine, leucine and isoleucine degradation
mkn00310  Lysine degradation
mkn00330  Arginine and proline metabolism
mkn00340  Histidine metabolism
mkn00380  Tryptophan metabolism
mkn00410  beta-Alanine metabolism
mkn00561  Glycerolipid metabolism
mkn00620  Pyruvate metabolism
mkn00625  Chloroalkane and chloroalkene degradation
mkn00903  Limonene and pinene degradation
mkn01100  Metabolic pathways
mkn01110  Biosynthesis of secondary metabolites
mkn01120  Microbial metabolism in diverse environments
mkn01130  Biosynthesis of antibiotics
Brite
KEGG Orthology (KO) [BR:mkn00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    MKAN_16665
   00053 Ascorbate and aldarate metabolism
    MKAN_16665
   00620 Pyruvate metabolism
    MKAN_16665
  09103 Lipid metabolism
   00071 Fatty acid degradation
    MKAN_16665
   00561 Glycerolipid metabolism
    MKAN_16665
  09105 Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    MKAN_16665
   00310 Lysine degradation
    MKAN_16665
   00330 Arginine and proline metabolism
    MKAN_16665
   00340 Histidine metabolism
    MKAN_16665
   00380 Tryptophan metabolism
    MKAN_16665
  09106 Metabolism of other amino acids
   00410 beta-Alanine metabolism
    MKAN_16665
  09109 Metabolism of terpenoids and polyketides
   00903 Limonene and pinene degradation
    MKAN_16665
  09111 Xenobiotics biodegradation and metabolism
   00625 Chloroalkane and chloroalkene degradation
    MKAN_16665
Enzymes [BR:mkn01000]
 1. Oxidoreductases
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.1  With NAD+ or NADP+ as acceptor
    1.2.1.3  aldehyde dehydrogenase (NAD+)
     MKAN_16665
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Aldedh
Motif
Other DBs
NCBI-ProteinID: AGZ51725
UniProt: U5WUJ9
LinkDB All DBs
Position
complement(3638613..3640082)
Genome map
AA seq 489 aa AA seqDB search
MSDSHTTEYDKLFIGGKWTEPSTSEVIEVHCPATGEYVGKVPLAAGADVDAAVAAARAAF
DNGPWPATPPKERAAVLAAAAKLLEERKGLFTKLLADETGQPPTIIETMHWMGSMGALNF
FATQAVDQVKWREIRTGSYGQTIVHREPVGVVGAIVAWNVPLFLAINKLGPALLAGCTVV
LKPAAETPLTANALAELLAEAGLPEGVLSVVPGGIETGQALTSNPDVDMFTFTGSSAVGK
EVGKRAAELLKPCTLELGGKSAAIMLEDVDLASAVPMMVFSGVMNAGQGCVNQTRILAPR
SRYDEIVDAVSTFVQALPVGPPSNPAVQVGPLISEKQRARVEGYIAKGIEEGARLVCGGG
RPEGLDNGFFVQPTVFADVDNKMTIAQEEIFGPVLSIIPYDTEEDAIKIANDSVYGLAGS
VWTTNIPHGIEVSEKIRTGTYGINWYAFDPCCPFGGYKNSGIGRENGPEGVEHFTQQKSV
LMPMGYTVE
NT seq 1470 nt NT seq  +upstreamnt  +downstreamnt
atgagcgacagccacacgaccgaatacgacaaacttttcatcggcggcaagtggacggaa
ccgtcgacctccgaagtcattgaagtgcactgccccgccaccggcgagtacgtcggcaag
gttccgctggcggccggcgccgatgtcgacgccgcggttgcagcggcccgggcggcattc
gacaacgggccgtggccggcgaccccgccgaaggagcgggcggcggtgctggccgccgcg
gccaagctgctggaagaacgcaaaggcctatttaccaaactgctcgccgacgagaccggt
cagccgccgacgatcatcgagacgatgcactggatgggctcgatgggggcgctgaatttc
ttcgccactcaggccgtcgaccaggtcaagtggcgggagatccgcaccggctcctacggc
cagaccatcgtccatcgtgagcccgtcggtgtggtgggcgcgatcgtggcgtggaacgtg
ccgctgttcctggccatcaacaagctgggccccgcgctgctcgccggctgcaccgtggtg
ctcaagccggccgccgaaacccctttgacggctaacgctttggctgagttgctggccgag
gccggcctgcccgaaggggtgctgtcggtggtgcccggcggtatcgagaccggccaggcg
ctgacctccaaccccgacgtcgatatgttcaccttcaccggcagctcggccgtcggcaag
gaggtgggcaagcgcgcagccgagctgctcaagccatgcacgctggaactcggcggcaaa
tcggcggccatcatgctcgaagacgtcgatctggccagcgctgtcccgatgatggtgttc
tccggcgtgatgaacgccgggcagggctgcgtgaaccagacgcgcattctggcgccgcgc
tcccggtatgacgaaatcgtggacgcggtaagcactttcgtgcaggcactgccggtgggg
ccgccgtcgaacccggccgtacaagtggggccgctgatctcggagaaacagcgcgcccga
gtggagggatacatcgccaagggcatcgaggagggcgcgcggctggtgtgcggcggtggc
cgtcccgaaggcctggacaacggattcttcgtgcagccaacagttttcgccgacgtcgac
aacaagatgacgatcgcccaggaggagatcttcgggccggtgctgtcgatcatcccctac
gacaccgaggaggatgcgatcaagatcgccaacgattcggtgtacgggctggccggcagc
gtctggaccaccaatatcccgcacggtatcgaggtctccgagaagatccgcaccggcacc
tacggaatcaactggtacgccttcgatccctgctgcccgttcggcggctacaagaactcc
ggaatcgggcgcgagaacgggccggaaggtgtcgagcacttcacccagcagaagagcgtg
ctgatgccgatgggctacaccgtcgagtaa

DBGET integrated database retrieval system