KEGG   Mycobacterium kansasii ATCC 12478: MKAN_16670Help
Entry
MKAN_16670        CDS       T02887                                 

Definition
(GenBank) SAM-dependent methyltransferase
Organism
mkn  Mycobacterium kansasii ATCC 12478
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Methyltransf_11 Methyltransf_25 Methyltransf_23 Methyltransf_12 Methyltransf_31 Ubie_methyltran Peptidase_M66
Motif
Other DBs
NCBI-ProteinID: AGZ51726
UniProt: U5WUZ0
LinkDB All DBs
Position
complement(3640127..3641116)
Genome map
AA seq 329 aa AA seqDB search
MAHETRPKLIDIVGGANQAREARNGREPGANQAREARNGREPAANQAREPRTAANGREQP
RTADVRRVWPVAVASHVTDVVARRATLTRSLRLLSLFRYERSDPARFYDALAADTATMVG
DLWLAGHGEPPTGRTLLDVGGGPGYFASAFADAGVRYIGVEPDPAEMHAAGPANAGAPGV
FVRASGMALPFADDSMDICLSSNVAEHVPRPWQLGAEMLRVTRPGGLVVLSYTVWLGPFG
GHEMGLTHYLGGARAAARYTRKHGHPAKNNYGSSLFAVSVADGLKWAASTGAAIAAFPRY
HPRWAWWLTTVPLLREFLVSNLVLVLQPR
NT seq 990 nt NT seq  +upstreamnt  +downstreamnt
atggcgcatgagacccgtcccaagctgatcgacatcgtgggcggcgcgaaccaggcgcgg
gaggcgcgaaacgggcgcgaaccaggcgcgaaccaggcgcgggaggcgcgaaacgggcgc
gaaccggccgcgaaccaggcgcgcgagccgcgaacagccgcgaacggccgcgaacagccg
cgaacagctgatgtgcgtagggtgtggccggtggccgtcgcctcccatgtcaccgatgtc
gtagcgcgccgggcgacactgacccgttcgctgcggttgctgtcactgttccgctatgag
cggtccgacccggcacgcttctacgacgccctggcagccgacaccgcgacgatggtcggt
gatctttggctggccggccacggggagccgccgaccggtcgcacactactcgacgtgggc
ggtggtcccggatacttcgcctcggcgttcgctgacgccggagtccgctacatcggcgtc
gaaccggaccctgccgaaatgcacgccgcgggccccgcaaacgccggcgctccgggcgtt
tttgtgcgggcctcgggcatggcactgccattcgccgacgactcgatggacatctgcctg
tcttccaatgtcgccgagcacgtgccgcggccgtggcagctcggcgccgagatgttgcgg
gtgaccaggccgggcgggttggtcgtgctctcttataccgtctggctcggcccgttcggc
ggacacgagatgggtctgacccattacctcggcggtgcccgcgccgccgcgcgctatacc
cgaaaacacggccacccggcgaaaaacaactacgggtcgtcgttgtttgcggtctcggtg
gccgacggtctgaagtgggccgccagcaccggtgccgcgatcgccgcatttccccgctac
cacccgcgatgggcgtggtggctgacgaccgtgccgctgctgcgggagttcttggtgagc
aacctggtgctggtcctacagccgcgataa

DBGET integrated database retrieval system