KEGG   Mycobacterium kansasii ATCC 12478: MKAN_16675Help
Entry
MKAN_16675        CDS       T02887                                 

Definition
(GenBank) glycosyl transferase
Organism
mkn  Mycobacterium kansasii ATCC 12478
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Glycos_transf_1 Glyco_trans_1_4 Glyco_transf_4 Glyco_trans_4_4 Glyco_trans_1_2 CARMIL_C DUF899
Motif
Other DBs
NCBI-ProteinID: AGZ51727
UniProt: U5WS27
LinkDB All DBs
Position
3641493..3642656
Genome map
AA seq 387 aa AA seqDB search
MSGLRSVLLLCWRDTGHPQGGGSETYLQRIGAQLVASGIKVTLRTARYPGAPRHDVIDGV
RISRAGGRYSVYVWALVAMALARFRLGPLRRVRPDVVVDTQNGLPFLARLLYGRRTVVLV
HHCHREQWPVAGPVLGRLGWFVESKLSPRLNRHNQYVTVSLPSARDLVALGVDNGRIAVV
RNGLDEAPAQTLSVPRAATPRVVVLSRLVPHKRIEDALDAVAELRRRNPGIPGLHLDVVG
GGWWRQRLVDHVNRLGISDAVTFHGHVDDLTKHHVLQSSWVHLLPSRKEGWGLAVVEAAQ
HSVPTIGYRSSGGLSDSIIDGVTGILVDSHRELVDRLEQLLSDPILRDQLGAKAQVRSGE
FSWQQSAEAMRTVLETVLAEDRLSGVV
NT seq 1164 nt NT seq  +upstreamnt  +downstreamnt
atgtctggactgcgctcggtgttgctgctgtgctggcgcgataccgggcatccccagggc
ggtggcagcgaaacctatttgcagcgcatcggcgcgcagctggtcgcatccggtatcaag
gtcacgttgcgtaccgcccgctatccgggggccccacgacacgacgtcatcgacggggtg
cggatcagccgcgccggtggccgctattcggtgtacgtgtgggcgctggtggcgatggca
ctggcgcggttccggttgggcccgctgcgccgggtccggccggacgtggtggtcgacacc
caaaacggtctgccgtttctagcccggctcttgtatgggcgtcgcacggtggtgctggtc
caccattgtcatcgcgagcagtggccggtggccggcccggtgctcggtcggctgggctgg
ttcgtcgaatcgaagttgtcgccgcggctcaaccggcacaaccagtacgtgactgtgtcg
ttgccgtcggcgcgtgatctggtcgccctgggtgtggataacgggcggatcgcggtggtc
cgcaacggactcgacgaggcgccggcgcagacgttgtccgttccgcgcgcggccacgccg
cgggtggtggtgctgtcgcggctggtaccgcacaagcggatcgaggatgcgctggacgcc
gtggcggagctacggcgacgaaaccctgggataccgggtctgcacctcgacgtggtcggt
ggcggctggtggcggcagcgactcgtcgaccacgtgaaccggctcggcatttccgacgcg
gtgactttccatggtcacgtcgacgacctcaccaaacaccatgtgttgcaaagctcttgg
gtacacctgttgccgtcgcgcaaggaggggtggggtctggcggtggtggaggcggcccag
cacagcgtgcccacgatcgggtatcgatcctccggcggtctgtccgactcgatcatcgac
ggggtgaccggcatccttgtggacagccaccgcgaactggtggaccggctcgaacaactg
ctttccgatccgatcctgcgcgatcaactcggcgccaaggcgcaagtgcgtagcggcgaa
ttctcttggcaacaaagcgccgaagccatgcgcacggtgctcgaaacggtgctggcggaa
gaccgcctcagcggcgtggtgtaa

DBGET integrated database retrieval system