KEGG   Mycobacterium kansasii ATCC 12478: MKAN_16680Help
Entry
MKAN_16680        CDS       T02887                                 

Definition
(GenBank) membrane protein
Organism
mkn  Mycobacterium kansasii ATCC 12478
SSDB OrthologParalogGene clusterGFIT
Other DBs
NCBI-ProteinID: AGZ51728
UniProt: U5WR86
LinkDB All DBs
Position
complement(3642705..3644390)
Genome map
AA seq 561 aa AA seqDB search
MRWLRPGYALALALLVLLPLLRPGYLLLRDAVSTPRSYLSAGALGLTAAPRATPQDFAVA
LASHLVDGGIVVKALLVLGLWFAGWGAARLVSVVLPAAGAAGQFVAITLAVWNPYVAERL
LQGHWSLLLGYGCLPWVATAMLGLRLGGSGFFALAFWIALAGLTPTGLLLAATVALTCVA
APGDGRPRWLCAATGLGFAVVGALPWLTASALGSLTSQTAANGLGVSAFAPRAETGLGTL
ASLASLGGVWNGDAVPDSRTTLFAVASAAVLLAVVAVGLPAALRRATAVPLLVLAAVSVL
VPAGLATGPGLHVLTAVVDAVPGLGVLRDGQKWVALAVPGYTVCGAGAVVTLARWWRPAV
AGLVCCVALVLALPDLAWGVWGRVTPVHYPSGWAAVAAAINREPADVAVLPAGTMRRFSW
SGPAPVLDPLPRWVRADVLTTGDLVISGVTVPGDGVHAREVQELLLRGADPSALARAGVG
WVVVESDSAGDMGSAARTLDRLTPTYRDTELALYRVGGQADGVAVAGLRATMLAHWVWLC
LLLAGAAGMAGCWVRRHLTRG
NT seq 1686 nt NT seq  +upstreamnt  +downstreamnt
gtgcgctggttgcgaccgggctatgcgttggctctggcgctactggtgctgctgccgctc
ctgcgacccggatatctgctattgcgtgacgcggtgtccaccccacggtcatacctatcc
gctggcgccctcgggctgacggcagcgcctcgggcaacgccgcaggatttcgcggtggcg
ctggcgtcgcatctggtcgacggcgggatcgtggtgaaggcattactggtgctgggcctg
tggttcgcgggctggggcgcggcccgactggtgtcggtggtgctgccggcggcgggagca
gctggccagttcgtcgcgatcaccctcgcggtgtggaatccctatgtcgctgaacgcctt
ttgcaggggcattggagcctgttgctcggctacggctgcctgccgtgggttgccacggcg
atgctggggttgcgcttgggcgggtccggcttttttgccctggcgttttggatcgcgctg
gccggactgaccccgaccgggctgctgctcgccgctacggttgccctgacctgcgtggcc
gctcccggtgacggccggccccgttggctttgcgccgcaacgggattgggctttgcggtg
gttggcgcgctgccctggctgacggcatcggccctggggtcgttaaccagccaaaccgcg
gcgaacgggctgggcgtcagcgcgttcgcgccgcgtgccgaaaccggcctgggcacgctc
gccagcctggccagtctcggcggagtttggaatggtgatgccgtacccgattcgcgcaca
acgcttttcgcggtggcctcggccgcggtgctgctcgccgtggtagcggtcggacttccc
gcggcgctgcgtcgggcgacagcagtgccgctgttggtgctggcggcggtatcggtgctg
gtgccggcgggattggccaccggcccggggctgcatgtgctgaccgcggtggttgacgcg
gtacccgggctgggtgtgctgcgggacgggcagaagtgggtggcgctggcggtgccgggt
tacacggtgtgcggcgctggggcggtggtgacgctggcacgttggtggcggcctgccgtg
gcggggttggtctgctgtgtggccctcgtcttggcgttgccggacctggcgtggggcgtg
tggggcagggtcacacccgtgcactacccgtcggggtgggcggccgtcgcggcggcgatc
aaccgtgagccggcggatgtcgcggtgctgcccgccggcaccatgcggcgcttttcctgg
tcggggcccgcgccggtactcgatccgttgccccgctgggttcgcgccgatgtgctgacg
acgggtgatctggtcatttccggcgtgacggttcccggggacggcgttcacgcccgcgag
gtgcaggagttgctgctgcgcggggccgatccgtcggcgttggcgcgggcgggagtcggc
tgggtggtcgtcgaatcggacagcgccggcgacatgggttcggctgcgcgcacgctcgac
cggctgacaccgacgtatcgtgacaccgaattggctctctaccgggttggcggccaagcc
gacggcgtcgctgttgcgggcctccgagcgacgatgcttgcgcattgggtatggctctgc
ctgctgctcgcgggcgcggcgggcatggccggctgctgggtgcggcgacacttaaccaga
ggctaa

DBGET integrated database retrieval system