KEGG   Mycobacterium kansasii ATCC 12478: MKAN_20155Help
Entry
MKAN_20155        CDS       T02887                                 

Definition
(GenBank) alanine racemase
  KO
K01775  alanine racemase [EC:5.1.1.1]
Organism
mkn  Mycobacterium kansasii ATCC 12478
Pathway
mkn00473  D-Alanine metabolism
mkn01100  Metabolic pathways
mkn01502  Vancomycin resistance
Brite
KEGG Orthology (KO) [BR:mkn00001]
 Metabolism
  Metabolism of other amino acids
   00473 D-Alanine metabolism
    MKAN_20155
 Human Diseases
  Drug resistance
   01502 Vancomycin resistance
    MKAN_20155
Enzymes [BR:mkn01000]
 5. Isomerases
  5.1  Racemases and epimerases
   5.1.1  Acting on amino acids and derivatives
    5.1.1.1  alanine racemase
     MKAN_20155
Peptidoglycan biosynthesis and degradation proteins [BR:mkn01011]
 Precursor biosynthesis
  Racemase
   MKAN_20155
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Ala_racemase_N Ala_racemase_C
Motif
Other DBs
NCBI-ProteinID: AGZ52355
UniProt: U5WWD1
LinkDB All DBs
Position
4399583..4400827
Genome map
AA seq 414 aa AA seqDB search
MIGTVLGEWLRTDTQTSGSTTSLAVTPISRTPGVLAEAVVDLGAVEHNVRVLREHAGSAQ
VMAVVKADGYGHGATRVAQAALAAGAAELGVATVDEALALRADGITAPVLAWLHPPGIDF
GPALVADVEIAVSSTRQLDELLDAVARTGRTATVSVKVDTGLNRNGVPPALYPEMLARLR
QAAAEHAIRLRGLMSHLVYADAPQQPINDIQAQRFRDMLSYAREEGVTFEVAHLSNSSAT
MARPDLTLDLVRPGIAVYGLSPVPERGEMGLVPAMTVKCAVALIKSVPAGEGVSYGHTWI
APHDTTVALLPIGYADGVFRSLGGRLEVLINGRRRPGVGRICMDQFVVDLGPGPVDVAEG
DEAILFGPGARGEPTAQDWADLVGTIHYEVVTSPRGRISRTYLEAETVESQRIP
NT seq 1245 nt NT seq  +upstreamnt  +downstreamnt
gtgatcggaaccgttctgggagaatggctgcgaaccgatacacagacgagtgggagcacg
acttcgttggccgttacgccgatatcccggacaccgggcgtcctggccgaggccgtggtc
gacctgggcgccgtcgagcacaacgtgcgggtgttacgcgagcacgccggaagcgcgcag
gtcatggccgtcgtcaaggccgacggctacggccacggcgcgaccagggtcgctcaagct
gcgttggctgcgggggcagccgaactcggcgtcgccaccgtcgacgaggcgctggcgttg
cgcgccgacggcatcaccgcgccggtgctggcctggctccatccgcccggtattgatttc
ggtccggcgctggttgccgacgtcgaaatcgcggtctcgtcgacgcgtcagctcgacgag
ctgctggatgcggtggcccgtaccggccggacggcaacggtgagcgtcaaggtcgacacg
ggcctcaaccgcaacggcgtgccgccggcgctgtacccggagatgctggccaggttgcgt
caggccgctgccgagcatgcgatccggctgcgggggctgatgtcgcacctggtgtacgcg
gacgcaccgcaacagcccatcaatgacattcaggcccaacggttccgggacatgctgtcg
tacgcccgtgaagagggcgtcaccttcgaggtggcgcacctgtccaattcgtcggcgacc
atggcccgtccggatctgaccctcgatctggtgcgtccgggcatcgcggtgtacgggttg
agcccggtacctgagcggggggagatgggcctggtgccggccatgaccgtgaaatgcgct
gtggcgctgatcaagtcggttcccgcaggagagggcgtgtcgtacgggcacacctggatc
gcgccgcacgacaccacggtggcgctgctgccgatcggttacgccgatggcgtgttccgg
tcgctgggcgggcgtctcgaggtgctgatcaacggccggcgacgaccgggcgtcggcagg
atctgcatggaccagttcgtcgtcgacctcggccccggcccggtcgacgtggccgaaggt
gacgaggccattctgttcgggcccggcgcccggggcgagcccaccgcgcaggactgggcc
gatctggtgggcaccatccactacgaagtggtaaccagtccgcggggacggatcagcagg
acctatctcgaggctgaaaccgttgaatcccaacgaatcccatag

DBGET integrated database retrieval system