KEGG   Mycobacterium kansasii ATCC 12478: MKAN_20570Help
Entry
MKAN_20570        CDS       T02887                                 

Definition
(GenBank) Fatty acyl-AMP ligase FadD28 and polyketide synthase
Organism
mkn  Mycobacterium kansasii ATCC 12478
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ketoacyl-synt Acyl_transf_1 AMP-binding KR PS-DH Ketoacyl-synt_C PP-binding KAsynt_C_assoc ADH_zinc_N_2 ADH_zinc_N adh_short Thiolase_N Epimerase ADH_N
Motif
Other DBs
NCBI-ProteinID: AGZ52432
UniProt: U5WU12
LinkDB All DBs
Position
4500440..4510159
Genome map
AA seq 3239 aa AA seqDB search
MLQERASSRPNETAFTFVDYEQDRAGVAESLTWSQLYRRTRNVAQELNARGSTGDRAVIL
APQGLEYVLAFLGALQAGQIAVPLSMPLGGASDERVSAVLRDAYPSTILTTSAVAGTIAE
CVRSEAGDRGAPSLIEVDLLDLDSQNALGAEAPNLPDIAYLQYTSGSTRTPAGVEISHKN
IHVNVEQILSSLYRERGEVAPPDTTVVSWLPFFHDMGLVLGIAIPILGGFAGVLTSPAAF
LQRPARWMQLTASNSSVFTGGPNIAFELAAAKTSDDDMAGLDLGDVRNIVSGAERVQPAT
LRRFAKRFAAFNLDPRVLRPSYGLAEATVYVASRESDQPPLAVNFESEELTAGRAKRCAS
GDGTPLVSYGMPRSPMVRIVDPDTRIECPEGTVGEIWAHGDNVSTGYWQKPQETERTFGA
TLVTPSAGTPEGPWLRTGDLGVVSEGELFIIGRIKDLLIVYGRNHSPDDIEATIQEITGG
RCVAIAVPDDDGVEKLVTIVEFKSRGDSDEAMHLMSVVRREITSRISKSQGLSVADLVLV
PPHSIPLTTSGKVRRRDCLHLYLRDEFTRLDGQTRRPEKRVAQDSATSAAADMTLAQRLR
TLRRQQDELLLGMVCSQSATVLGYPSPEDIDPECAFQDLGFDSVKATELLDRLNTVTGLA
LPPTLAFDYPTPAALAAHLGQLLSGSVAAAAPVQPQVATNEPVAVVGMACRFPGGADSAA
ALWDLVAGGAEAVGEFPTDRGWDLANLFDPDPDAVGKTYTRAGAFLADASGFDAEFFGIS
AREAQTMDPQQRLLLEVCWEALETSRIDPAALVGSETGVFVGAWSQQYGGDGSDGAEGYA
MTGTSTSVASGRVAYALGLQGPAITVDTACSSSLVAAHLACQSLRNGECGLALAGGVTVM
TTPAVFTEFSRQRGLAADGRCKAFAAAADGTGWGEGAAVLVLERLGDAHRNNHPVLAVIA
GSAINQDGASNGLTAPNGPAQQRVITQAVANAGIGLDEVDVVEAHGTGTTLGDPIEAGAL
IATYGAARGPEHPLWLGSIKSNIGHTQAAAGVAGMIKMIAALNHDTLPVTRNVDRPSPHI
DWSAGTVRLLTEAVPWPLADHPRTAAVSSFGISGTNAHLILRQAPTPVAEPAQPRPAAAR
TEDGAEVGPPRLPLWPVSARTRAALCAQADRLHQLLVCHPDLDLTDVAYSLASTRTHHPY
RAVVTVPADSTDPRAELVAALEALSADQPHPQLVHNHQRATSAAKTVFVFPGQGGQYPGM
AAQLYGRHPTFSAAIDECDQALGACTGWSVRAVLRGEPGAPSLDRVDVVQPMLFAVMVSL
ARTLISYGIEPDAVIGHSQGEIAAAYVAGVFTLEQAAKIVALRSAALAELSGAGAMASVL
LAADDVDARLQSYGDALAVAAVNGPTHTIISGGPEAMARFIADCEADNVQIRSITVDYAS
HCAQVEPLRERLLDELAGLTPKPGRIALHSTVHGVMSDQPLDTTTMTADYWYANVRQPVR
FYDSIKHLLAAAEQVFVEVSPHPVLAPALADILAGTAGRPGSAVIPTLHRERPDLDTLTA
TLARLHVHGQSPAWPALYPHARQVELPTYPFQHHRYWLTPRSGTDAAGLGLDQPQHPLLG
AITTLADRDEVIATGRVVLGSQAWLAAHRVGDVVVLPATGFVDLVLGVGDYVGCPVIDEL
VLHTPLVLAEHTPTDIQISVADADGAGRRSVNVHARTGTDHRAEAGWVLHASGTLRPGQT
AAGEPPVPALPATAVDVQRFYQQLADCGLHYDPPFCSVRGIGLQPGDPDHIYAEVALPAG
TDITGYGMHPALLDAALHPIAAALGAGADAEPAVLRLPFVFSGVTLYATAATRLQVWLTR
TGDDTFTLYASDPAGAPVIRIDTVVVRVLPDMATLSAPTTAAPSVPGLWELAWPPLSTAA
AAAADRPHWEVVAEDLDALSTSLRNGPVRPDLDAVRPCPPVVLWSLAARQRPGDDADAVS
SIHGLTRRALAGLQAWLARPDTSGTALVVLTCRAVAISPYDRAPDLAQAAVWALLHSAHN
EYPGRIRLVDTDLAGASADTLLHLLATFAGTGGEPQLALRDGVAHIPRLTPARALTPPPT
PHWQLITTGRGDLANLTLVPTPAPTTLGPGQIRVQIRAAGLNFHDVVVALAAISDEGLGA
EAAGVVVDTADDVTDFAPGDAVMGLFPNNAFAPTATTDHRSVVAVPPGWSYPQAASVPAA
YITAYSVLIDIAQVSAGQRVLIHSAAGGVGQAAIRIAAHLGAEVFATAHPAKHHILRGLG
IPEDHIASSRTLDFGDTFAAAGGGRGMDVVLNSLRGEFVDASLHLVAPGGRFVEIGKTDI
RSAADVAQTHPGLSYHAYDLSAATPEQVQHAWAGVRELISGGVIAPLPVTRYGLLRAPQA
FRDMSQARHTGKIVLTPPAVLDPQGTVLITGGTGMLGGLFAEHLITGYGARRLLLTSRRG
ASTPEAVELAQRLQGLGADVTISACDCANPSELAALIGSIPAEHPLTAVIHAAGVLDDAV
TSQLTAQQLDNVLAAKADSAWYLHQLTANTELAAFVLFSSAAGVLGAPGQANYAAANAVL
DALARERPAAISLAWGYWQPSSGMTGDLDTRDRTRLTRSGMVPITAGQGLALFDAALSQQ
HPNLIPAPLGTRALSALARENSLPPILSALVTARPQAAAADSRALAARLAGLAPERQHDM
LANLVITATAAVLAHPDPAAMDPEQPFKDLGIDSLSALELRNTLSAQTGVALPATVTFDH
PSPAMLAAHLADLLRVTAVPAGPAAEVATGDAEPVDNRLAYLDQAAFLGLRAGHVSLLQV
TWIYDRAVDLDGLRRFHRNLGRGLLGRRIERSPVPFARDHWVLAPAPAEIDFVATPRRRS
DVGAWVDERARRPVDPEWGPAWHLGVLPLEDGGTAISLVASHAVVDAIAFGQAIVDAAEG
RTRDLGYLPAGSRTLRRALRADLRQTVEELPDVLHAVGGVVRRLRRDREEFRSSIKAAPP
SPRTAGGDQTVAVPAVTACIDLAEWDACAKRLGANSNSLVGGVACRLAVRAGRVQGDGTV
TLRFVVSLRTEGDTRGNALTAVDVAVDPEHAARNLGEMHAKITRAVLEAMEDSDNELLAP
LPLAAVTPTWVARRLLGMAAGGPGLPVTCSNVGDLPPAANRPDGTDADSAYMRQIEPNIT
RNELEGTGGRMLLSSGRSRGKMRIGVSAYLVGRSNTKDELRELVSRTLAEFDLNAEIDC
NT seq 9720 nt NT seq  +upstreamnt  +downstreamnt
gtgctgcaggaacgtgccagttcgcggcctaacgagacagctttcacgtttgtcgactac
gagcaggaccgggcgggcgttgccgaaagtctgacatggtcgcagctgtaccggcggacg
cgcaacgtcgcacaagagctcaacgcccgcgggtcgaccggcgaccgggccgtgatactg
gcgccgcaaggactggaatacgtcctggcgtttctgggcgcattgcaggccggtcagatc
gcggttccgctgtcgatgccgctgggtggcgccagcgatgagcgggtcagcgcggtgctg
cgcgacgcgtacccgtcgacgattctgacgacatcagccgtcgccggcaccatcgccgag
tgcgtcaggtccgaagccggcgaccgcggcgcgccgtcgctgatcgaggttgacctgctg
gacctggactcccagaacgcgctcggtgccgaagccccgaacctgccagacatcgcctat
ttgcagtacacctcggggtccacccgcacgccggcgggagttgagatctcgcacaagaac
attcacgtcaacgtcgagcaaattctatccagcttgtatcgggagcgcggcgaggttgct
ccgccggacaccacagtcgtgtcgtggctgccgttcttccacgacatgggtttggtcctg
ggaattgcgatcccgattctgggcggatttgcgggcgtgctgaccagcccggcagcgttc
ctgcaacgaccggcgcggtggatgcaattgacggcaagcaacagctccgtattcaccggc
ggacccaacattgctttcgaattggcggcagcaaaaacgtcagatgacgacatggccggg
cttgacctcggggacgtgcgcaacattgtcagtggtgccgagcgcgtgcaacccgcgacg
ctgcggcgcttcgccaagcgattcgccgcgttcaatctcgaccccagggtgttgcggccc
tcgtatgggcttgcggaagccacggtgtacgtggcgagccgcgaaagcgaccaaccaccg
ctagcggtcaatttcgaatccgaggaactgaccgccggccgcgcgaagcggtgcgccagc
ggagacggcacaccgctggtcagctacggcatgccgcgctcgccgatggtgcgcatcgtc
gacccggacacccgtatcgagtgtccggagggaacggtcggtgagatctgggcacatggt
gacaacgtctcgacgggctattggcagaaaccgcaagagacggaacggaccttcggtgca
accctggtcacaccgtcggccggcacgccggaggggccttggctgagaaccggagatctg
ggcgtcgtctccgaaggtgagctgttcatcatcggccgcatcaaggatctgctgatcgtg
tacggccgcaaccactctcccgacgacatcgaggcgacgatccaggagatcaccggaggc
cgttgtgtggcgatcgccgttcccgacgacgacggcgtcgaaaagctggtcaccatagtc
gaattcaagtcgcgcggcgactccgacgaggcgatgcacctgatgagtgtcgtcaggcgg
gaaatcacctccaggatttcgaagtcgcagggtctgagtgtggcggatctcgttctggtt
ccgcctcattcgattccgctgaccacaagcggcaaggtccggcgacgggattgtctacac
ctctacctgcgcgatgagttcacccggctggacgggcagacccgccggccggaaaagcgc
gtggcccaggacagcgccacgagcgccgcggccgacatgacgttggcacaacgcctgcgc
acgctgcgccgccagcaagacgaactcctgctcgggatggtgtgctcgcagtcggcaacc
gtcctgggctatcccagcccagaggacatcgaccccgagtgcgcgtttcaggacctgggg
ttcgactcggtgaaagccactgaattgctcgaccgcctcaataccgtcaccgggctggca
ttgccacccaccctggctttcgactaccccaccccggccgcgttggctgcccacctgggc
cagctgctgagcgggtcggttgcggcggctgcgccggtccagccgcaggtggcgacgaac
gagccggtagcagtggtggggatggcctgccggttccccgggggcgcggattcggcggcg
gcgctgtgggatctggtggccggcggcgccgaggcggtgggggagtttcccaccgatcgt
ggctgggatctggcgaatttgttcgatcctgatcccgatgcggtgggcaagacctacacg
cgtgccggggcgtttctggccgacgcgagcgggtttgacgccgagtttttcgggatctcg
gcgcgggaggcgcaaaccatggatccgcagcagcggctgctgctggaggtgtgctgggaa
gcgttggaaaccagccgaattgacccggccgcgttggtcggttcggagaccggggtgttc
gtcggagcctggtcgcagcagtacggcggggacggttccgatggcgcggagggatacgcc
atgaccgggacgtccaccagtgtggcttccggacgggtggcttacgcgctgggtttgcag
ggcccggctatcaccgtggacacggcatgttcgtcgtcgttggtggccgcgcatctggcg
tgccagtcgctgcgcaacggggagtgcggtctggccctggccggtggtgtcacggtgatg
actacgccggcagtgttcaccgagttctcccggcagcgcgggctagctgccgacgggcgt
tgtaaagcgtttgcggccgctgccgacggcaccggctggggcgaaggggccgcggtcctg
gtgctggaacggctcggcgacgcacaccgcaacaaccatccggtgctggcggtcatcgcg
ggatcggcgatcaaccaagacggtgcctccaacgggttgaccgcgcccaacgggcccgct
cagcagcgcgtcatcacccaggccgtggccaacgccggcatcgggctcgacgaggtcgac
gtcgtcgaggctcacggcaccggcaccacgctgggcgacccgatcgaggccggcgccctg
attgccacctacggtgccgcgcgggggccggagcacccactgtggttgggatcgatcaaa
tccaacatcggtcacacccaggccgccgccggtgtcgccggaatgatcaaaatgatcgcc
gccctcaaccatgacacgctgccggtgacccgcaacgtcgatcgccccagcccgcacatc
gactggtcggccggcactgttcggctactcaccgaagcggtgccctggccgctcgccgat
catccccgcaccgcggcggtgtcctcgttcgggatcagcggcaccaacgcccatctcatc
ctgcgacaagcccccaccccggtggccgagccggcgcagccccggcccgcggccgcgcgc
accgaggacggtgctgaggtcgggccgccccgactgccgctgtggccggtgtcggcgcgc
acccgcgcggcgttgtgcgcgcaggcagaccggctgcaccagttactggtctgccatccc
gacctggacctcaccgatgtggcctacagcctggccagcacccgaacccaccacccgtac
cgggccgtcgtgacggtaccggccgacagcaccgatccccgggctgagctggtggcggca
ctcgaagcgttatccgccgatcaaccgcacccgcaactcgtccacaaccaccaacgcgcg
acatcggcggccaaaaccgtgttcgtgttccccggccagggcggccagtaccccggtatg
gccgcccagctctacggccggcaccccactttctccgccgcgatcgacgagtgtgatcag
gccctgggtgcctgcacaggctggtcggtgcgtgcggtccttcgtggtgagccaggcgcc
ccctccctggatcgcgtcgatgtggtccagccgatgttgttcgccgtcatggtgtcgttg
gcccgcaccctgatcagttacgggatcgaaccggacgcggtgatcgggcactcccaaggc
gagattgccgccgcctacgtcgccggggtgttcacccttgagcaggccgccaaaatcgtg
gcactgcgcagcgcagccctcgcggagctatccggggccggcgccatggcatcggtgttg
ctggccgctgacgacgtggacgcgcgactgcagtcctacggtgacgcgctggcggttgcc
gcggtcaacggccccacccacaccatcatcagcggcggtcccgaagcgatggcgcggttc
atcgcagattgcgaagccgacaatgtccagatccgttccatcacagtcgattacgcctca
cactgcgctcaggtcgaaccgttgcgcgagcgcctgcttgacgagttggccgggctgacc
ccgaaaccgggacggatcgcgctgcattccaccgtgcacggcgtcatgtcggaccagccg
ctggacaccaccaccatgaccgccgactactggtatgccaatgtgcgtcaaccggtccgg
ttttacgacagcatcaaacatctgctggccgctgctgagcaggtgtttgtggaagtatca
ccgcatccggtgctggccccggcgctcgccgacattctggccggcaccgcggggcgtccg
ggctcggcggtcattcccaccctgcaccgcgagcgccccgacctggacaccttgactgcc
acgctggcccggctgcatgttcatggccaaagcccggcgtggccggcgctctatccccac
gcccgacaggtcgagctaccgacgtacccgttccagcatcaccggtattggctgaccccg
cgatccggcaccgatgccgccggcctggggctggatcaaccgcagcatccgttactcggg
gcgatcaccacattggccgatcgagacgaggtgatagccaccggtcgggtggttctcggt
tcacaggcctggcttgctgcccatcgggtgggtgacgtggtggtgttgcccgcgacgggg
tttgtcgatctggtcctgggggtcggggattacgtgggatgcccggtcattgacgagttg
gtgttgcacaccccgctggtgctggccgaacacaccccgaccgacatccagatcagtgtg
gccgacgccgatggggccgggcgacgctcggtcaacgtccatgcccgcaccggcaccgac
catcgggccgaggccggttgggtgttgcacgccagcggaacgctgcgtcccgggcaaacc
gctgccggtgaaccgcccgtcccggcgttgccggcgacggctgtcgatgtgcagcgtttc
tatcagcagctggccgactgcggcctgcactacgatccgccgttctgctcggtacgcggg
atcggcctccagccgggcgaccccgaccacatctacgcggaagtggccctgcctgccggg
accgatatcaccggttacgggatgcacccggcgttgctcgatgccgcgctgcacccgatc
gccgccgccctgggagccggggcggacgccgagccggcggtgctgcgccttccgttcgtg
ttcagcggggtcacgctgtatgcaaccgcggccacccggcttcaggtgtggctgacccgc
accggcgacgacaccttcaccctgtacgccagcgatcctgccggcgcgccggtaatccgc
atcgacacggtcgtcgttcgggtcctgcccgacatggcgactctgagcgcccccacgaca
gcggcgccgtcggtccctggtttgtgggagctggcctggccgcccctgtccaccgctgct
gccgcagcggccgatcggccgcactgggaggtcgttgccgaagatctcgatgcgctgtcg
accagcctgcgcaacggcccggtacgccccgatttggacgcggtgcggccatgcccgccg
gtggtgttgtggtcgttggcggcccggcaacgtcccggcgatgacgccgatgccgtatcg
agcattcatgggctgacccgacgggcgctggccgggctgcaggcctggttggcccgcccc
gacacatccggcacggcgttggtggttctgacgtgtcgcgcggtggcgatcagcccctat
gaccgggcgccggatctggcgcaggccgcggtgtgggcgctgctgcacagcgcccacaac
gagtatccgggccggatccggctggtcgataccgacctcgccggcgccagtgccgacacc
ctgctgcatctgctggccaccttcgccggcaccggcggtgagccgcaactggcgttgcgt
gacggtgtcgctcacattccccggctgaccccggcgcgggcgttgaccccgcccccgacg
ccccactggcagctgatcaccaccggtcgcggggatttggcgaacctgaccctggttccc
accccggcgccaacgacgttgggcccgggtcagattcgggtgcagatccgcgccgccggc
ctgaatttccatgacgtggtggtcgccctggcggcgatcagcgatgaaggccttggcgcg
gaagcggccggggtggtcgtcgacacggcagacgacgtcacggatttcgcgccgggggat
gcggtgatggggctgttccccaacaacgcgttcgcccccaccgccaccaccgatcaccgc
agcgtcgtggccgtcccgccgggatggtcctacccgcaagcggcttcggtcccggccgcg
tatatcaccgcgtacagcgttctgatcgatatcgcgcaggtgtcagcgggacagcgggtg
ctcatccactccgccgccggcggggtcggccaggccgctatccgcatcgcagcgcacctg
ggtgccgaggtgttcgccaccgctcatcccgccaagcaccacatcctgcgcgggctgggc
atacccgaggatcacatcgcctcttcgcgcaccctggacttcggtgacaccttcgccgca
gccggcggcgggcgcggcatggacgtggtgttgaacagtctccgcggcgaattcgtggac
gcgtcgctgcacctggtggccccgggcgggcgctttgtcgagatcggtaagaccgacatc
cggtcagccgccgacgtcgcacagactcatcccggcctgagctatcacgcctacgacctg
agcgcggccacccccgaacaggtgcaacacgcctgggccggggtgcgcgagttgatcagc
ggcggggtgatcgcgcccctgccggtgacgcgctacgggctgctgcgcgccccccaggcg
ttccgcgacatgagccaggcccgccacaccggcaaaatcgtgctcaccccgcccgcggtg
ctcgacccgcagggcacggtgttgatcaccgggggcaccggcatgctcggcgggctgttc
gccgaacacctgatcaccggttacggtgcgcgccggctgttgttgacctcgcggcgcggc
gccagcacgcccgaagcggtcgagctcgcccagcgcctgcagggtctgggtgccgatgtc
acgatcagcgcctgcgactgtgccaacccgagcgagctggccgccctgatcggctcgatt
cccgccgaacacccgttgaccgcggtcatccacgccgccggagtgctcgatgacgcggtg
accagccagctcaccgcgcaacagctcgacaacgtgctggccgccaaagccgacagtgcc
tggtatctgcaccaactcaccgccaacaccgagctggccgcgttcgtgttgttctcctcg
gccgcgggtgtcctgggcgccccgggacaggccaactacgcggccgccaacgccgtcctc
gacgcactggcccgtgaacggccggcggccatcagtctggcctgggggtattggcagccg
tcctccgggatgaccggggacctggacacgcgtgatcgcacccgtctgacccgcagcggg
atggtcccgatcaccgccggccagggtttggccctgttcgatgccgccctttcccagcag
caccccaatctgatccccgccccgctcggcacccgggcgttgtcggcgttggcccgggaa
aacagcctgcctccgatcctgtccgcgctggtcaccgcccggcctcaggccgccgcggcc
gactcccgcgcgctggcggcccggctggccgggctggcccccgagcgacaacacgacatg
ctggccaacctggtcatcaccgccaccgcggcggtgctggcacatccggacccggcggcg
atggatcccgagcagccgttcaaagatctcggcatcgactcgctcagtgcgctggagctg
cgcaacaccctgtcggcccaaaccggggtggccttgccggccaccgtcaccttcgaccac
cccagccccgcgatgctcgccgcccacctcgccgacctgctgcgcgtcaccgctgtgccc
gcgggtccggcggccgaggtcgccacgggtgacgccgagccggtggacaatcggctcgcg
tacctggatcaagccgcgttcctggggctgcgggcaggacacgtgtcgctgctgcaggtg
acatggatctacgaccgtgccgtcgaccttgacgggttgcggcgttttcaccgcaatctc
ggacgcgggttgttggggcgcagaatcgaaagatcgccggtaccgttcgcgcgtgatcac
tgggtgttggcgccggcgccggcggagattgacttcgtcgcgacgccgcggcggcgcagc
gatgtgggcgcgtgggtcgacgagcgggcgcgccgacccgtcgatccggagtgggggccg
gcctggcatctcggggtgttgccgctcgaggacggcgggacggcgataagtctggtggcc
tcgcatgcggtggtcgacgcgatcgctttcggccaggcgatagtcgacgcggccgagggc
aggacgcgagatctgggttatctgcccgcgggatcgcgcaccctcaggcgggcgctgcga
gcggatctccggcaaaccgtcgaggaactgcccgacgtattgcacgctgtgggtggcgtg
gttcgaaggcttcggcgtgatcgcgaggagttccggtcatcgatcaaagcggcgccgccg
tccccgaggacggccggcggcgaccagaccgtggcggttcccgccgtgaccgcatgtatc
gacctggcggagtgggatgcttgtgcgaaaagacttggcgcgaacagcaactcacttgtg
ggcggggtggcctgcaggctcgcggtgcgggccggacgggttcagggcgacggaacggtc
accctacgattcgtggtgtcgcttcggaccgaaggcgacacccgcggcaatgcgctgacc
gctgtcgacgtcgccgtcgaccccgagcacgcggcgaggaacctcggggagatgcacgcc
aagatcactcgagcggtcctcgaagcgatggaggattccgacaacgagttgctggcaccg
ctgccgctggccgcggtgacgccgacgtgggtggccaggaggctcctcgggatggcggcg
ggtggtcccggccttcccgtcacgtgctccaatgtcggtgatctgcccccggccgccaac
cggcccgacggcaccgatgccgactcggcgtacatgcgacagatcgagcccaatatcacc
aggaacgaactcgagggcacgggcggacgaatgctgctgagttcggggcgcagccgcggg
aagatgcgcatcggagtctctgcttatcttgtcgggcgctcgaataccaaagatgagctg
cgggagctggtgtcgcgtacgttggcggaattcgatctgaacgccgagatcgattgctag

DBGET integrated database retrieval system