KEGG   Methylomonas koyamae: MKLM6_0921Help
Entry
MKLM6_0921        CDS       T05118                                 

Definition
(GenBank) Serine/threonine protein kinase
  KO
K12132  eukaryotic-like serine/threonine-protein kinase [EC:2.7.11.1]
Organism
mko  Methylomonas koyamae
Brite
KEGG Orthology (KO) [BR:mko00001]
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:mko01001]
    MKLM6_0921
Enzymes [BR:mko01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.1  non-specific serine/threonine protein kinase
     MKLM6_0921
Protein kinases [BR:mko01001]
 Serine/threonine kinases: Other
  Bacterial family
   MKLM6_0921
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Pkinase Pkinase_Tyr APH PIP49_C Kinase-like Pkinase_fungal Haspin_kinase
Motif
Other DBs
NCBI-ProteinID: ATG89188
UniProt: A0A291IG75
LinkDB All DBs
Position
990628..991941
Genome map
AA seq 437 aa AA seqDB search
MDQIDNYKIVEKIGEGGMGEVYKGVDVMLEREVAIKLLRPELSSREDIVNRFRSEAVALG
RLNHSNIAVVYNFGKLPAGQFYMALEFVHGDTLDAVIKRSGSLPWQKAVKYALGILEGLD
HAHGFNIVHRDIKPANIVVTNHDTVKILDFGIARILETARLTRVGHLVGTLEYVSPEQIQ
GKDTDAKSDIYSVGVVLYEMLTGHIPFEKETEYDLIKSQIEEKPKAPHTLCGNIPPKLEK
LVLKALEKNPDKRFASARAFCDALIEVSNECADSTRAAPARLPSNKLWGFCREYPGPVFL
LALLAFGLIYFLWMQLGAADFAKPPDVATGPASQPPAALAPLAGNDGAAGGTPDQGPNKK
PDTGERLPPPPIVPIQPVAESPLDGARLPAPAKIGAVSAAEDNKARVKPPAPAKPKKERR
IADDDPGIGRAADNFFN
NT seq 1314 nt NT seq  +upstreamnt  +downstreamnt
atggaccaaatcgacaattacaaaatcgtcgaaaagatcggcgaaggcggtatgggcgaa
gtctataaaggcgtcgacgtgatgctggaacgggaagtcgcgatcaagttgttgcggccg
gagttgagttcccgggaggatatcgtcaaccgcttcagatcggaggcggtggcgctgggg
cggttaaaccattcgaacatcgccgtggtttataacttcggcaagttgccggccgggcag
ttttatatggcgctggagtttgtccacggcgacactctggacgcggtgataaaacgttca
ggctcgttgccgtggcaaaaagcggtcaagtacgcgctcggcattttggagggcctggac
cacgcccacggcttcaatatcgtccaccgcgacattaagccggcgaatatcgtcgtcacc
aaccacgatacggtcaaaatactggatttcggcattgccagaatcctggaaaccgccagg
cttacccgggtcggccatttggtcggcaccttggaatacgtctcgccggagcaaattcaa
ggcaaggataccgacgccaaatccgatatctattcggtcggcgtggtgctatacgaaatg
ctgaccgggcatatcccgttcgaaaaggaaaccgaatacgacctgatcaaatcgcaaatc
gaggaaaagccgaaagctccgcatacgctatgcggcaatattccgccgaaattggaaaag
ctggtgctgaaagccttggagaaaaacccggacaaacgctttgccagcgccagagcattt
tgcgatgcgctgattgaagtctcgaacgaatgtgccgattcgacgcgggcggcgcccgct
cgcctgccgtcaaacaagttatggggtttttgccgggaatatcccggcccggtatttctg
cttgcgctgttggctttcggcctgatctatttcttatggatgcaactgggcgccgccgat
tttgcgaaaccgcccgacgtcgccaccggaccggcgtcgcaacctcctgcggcgctggcg
ccgcttgccggcaacgatggcgcggctggcggcactccggaccagggcccgaataaaaag
ccggataccggcgaacgcttgccgccaccgccgatcgtgccgatccagccggttgccgag
agcccgttggatggtgcacgtttaccggcgccggctaaaatcggcgcggtttccgctgcg
gaggacaacaaagccagagtaaaacctcccgcgccggccaagcccaagaaagagcggaga
attgccgacgacgatcccggtatcggccgggcggccgacaattttttcaactaa

DBGET integrated database retrieval system