KEGG   Methylomonas koyamae: MKLM6_1558Help
Entry
MKLM6_1558        CDS       T05118                                 

Definition
(GenBank) superoxide dismutase
  KO
K04564  superoxide dismutase, Fe-Mn family [EC:1.15.1.1]
Organism
mko  Methylomonas koyamae
Brite
Enzymes [BR:mko01000]
 1. Oxidoreductases
  1.15  Acting on superoxide as acceptor
   1.15.1  Acting on superoxide as acceptor (only sub-subclass identified to date)
    1.15.1.1  superoxide dismutase
     MKLM6_1558
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Sod_Fe_C UCR_Fe-S_N Sod_Fe_N
Motif
Other DBs
NCBI-ProteinID: ATG89804
UniProt: A0A291IHM8
LinkDB All DBs
Position
complement(1696617..1697372)
Genome map
AA seq 251 aa AA seqDB search
MESVTTRRDFLSLAAAGAALSIVTPGIARAAETEAPTIALPNAFAADHAPKPLSFDPTKL
NGLSEKLIRSHWENNYGGSVKALNAVKQKLSVFLEDGNLPAYIYNDLKREHLLRTGSVVL
HELYFDNLGGTTGPDPALKNLISAAFGSFATWEKEFRRIGAGLGGGSGWVTLGLNLHTGT
LENYWHWDHQTAPAASLPILVLDMYEHSYQMDYGAAAPAYLDAFFKNIQWETVAARLDKA
LKLLAIARQAG
NT seq 756 nt NT seq  +upstreamnt  +downstreamnt
atggaatccgttactacccgccgcgattttttaagcctggccgctgccggtgccgcacta
tcgattgtgacgcctggcatcgcccgcgccgccgaaaccgaggcgccgactattgccttg
cccaacgcctttgccgccgaccacgcacctaaacccttgagtttcgatccgaccaaactg
aacggcttgtcggaaaagctgatccgctcgcactgggaaaacaattacggcggctcggtc
aaggcgctgaatgcggtcaaacaaaaactgtcggtatttctggaggacggcaacctgccg
gcttatatctacaacgacttgaagcgcgagcacctgctgcgcaccggctcggtggtgttg
cacgaactgtatttcgacaacctgggcggtaccacaggccctgaccctgcgttaaaaaac
ctaatctctgcggcgtttggttcgttcgcaacctgggaaaaagaattccgccgcatcggc
gccggcctgggcggtggctcgggctgggtcaccttgggtttgaatttgcacaccggcacc
ctggaaaactactggcattgggaccaccaaaccgcccccgccgccagcctgccgattctg
gtattggatatgtacgaacactcctaccaaatggactacggcgccgccgcaccggcctat
ctggacgcgttcttcaaaaacatacagtgggaaacggtggccgcgcggctagacaaggcg
ttgaagttattggcaattgctcgtcaagctggctga

DBGET integrated database retrieval system