KEGG   Methylomonas koyamae: MKLM6_2542Help
Entry
MKLM6_2542        CDS       T05118                                 

Definition
(GenBank) phosphoenolpyruvate carboxylase
  KO
K01595  phosphoenolpyruvate carboxylase [EC:4.1.1.31]
Organism
mko  Methylomonas koyamae
Pathway
mko00620  Pyruvate metabolism
mko00680  Methane metabolism
mko01100  Metabolic pathways
mko01120  Microbial metabolism in diverse environments
mko01200  Carbon metabolism
Module
mko_M00168  CAM (Crassulacean acid metabolism), dark
Brite
KEGG Orthology (KO) [BR:mko00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00620 Pyruvate metabolism
    MKLM6_2542
  09102 Energy metabolism
   00680 Methane metabolism
    MKLM6_2542
Enzymes [BR:mko01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.31  phosphoenolpyruvate carboxylase
     MKLM6_2542
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PEPcase PEPcase_2
Motif
Other DBs
NCBI-ProteinID: ATG90762
UniProt: A0A291IKD1
LinkDB All DBs
Position
2869250..2872048
Genome map
AA seq 932 aa AA seqDB search
MTNAQTYDDKALRSYFRLLKQILAQVLKTEAGPNISGMVEQLQRQFAALQRDNTPSRRRQ
LSDTLNKLPPEAQTEVIRAFSMFFSLLNIAEESANLHQRRRLAENDKHFWPGSFHDTLLN
LRQAGVDAEQLQCLLDNLSYMPVMTAHPTEAKRRAVRGALRNIFLSHEKLDDPRLKGYFR
AEVLERLHGQIQLLWKTDEVRARGMGVVDEIDAGLYYFPLSLFEATARVYRNFQRALHDV
YGTDAAAVKIPNFLVFGSWIGGDRDGNPNVKPETTALALRMQTRTVLRAYITRVAALREQ
LSYSYGLCRPTDAFLQSLQHERELLGDVAIALERSCRQEPYRHKLSLMKYRLEAALNRVE
QRIEQSSGAGDIHAYAGAPQFLADLHLIRESLISHGDQAVADLELLDLIRLVETFGFHLM
QLDVRQESTRHSDAVAEIFALALQIDYQALAESERLQLLGEAISAPGSLSYDNQLLSEAT
RETLEVFQVMADMRREIGADCFSRYVISMTHSASHIMEVLLLAAQTGLAGRIGGRWYCHV
GVSPLFETIEDLSHIDTVLRTLLAQPVYRALQQAYGQRQEVMLGYSDSCKDGGILASAWG
LYRAQQLVMEISDSEGIPCRLFHGRGGTVGRGGGPTHQAILAQPPATVRGQIKFTEQGEV
LFYRYNNMETAVYELTMGITGLMKASVSLVRPVATDQPEALTIMSELAAIGERGYRQLTE
HTPGFLDYFYETTPVTEIGQLNIGSRPSHRKKQDRSKKSVRAIAWVFAWAQSRQTFPAWY
GIGSSLENWCAGKPERLKTLRELYCTWPFFRNLLSNAQMALSKSDMDIAREYAALCADPE
VGKRIHGLIAAEHRRCVDWILEIAESDRLLADNPELAASLNRRNDYLGPLNFLQADLLRA
LRQADENDGDIPAMQPLLRTINAIAAGMRNTG
NT seq 2799 nt NT seq  +upstreamnt  +downstreamnt
atgaccaacgctcagacctacgacgataaagcgctgcgcagctacttccgtttgctgaaa
caaattctggcgcaagtgctcaaaaccgaagccggcccgaacatctccggcatggtcgag
caattgcaacgccaattcgccgcattgcaacgcgacaatactcccagccggcgccggcag
ttgtccgacacgctgaacaagctgccgcccgaagcgcaaaccgaagtgatccgcgccttc
agcatgttcttcagcctgctcaatatcgccgaagaatcggccaacctacaccagcggcgg
cgtctagcggaaaacgacaagcatttttggccgggctcgttccacgatacgctgcttaac
ttacgccaggccggcgtcgatgcggagcagttgcagtgtttgctcgacaatctgagctac
atgccggtcatgaccgcacatccgaccgaagccaagcgccgggcggtacgcggcgcgttg
cgcaacatcttcctcagccacgagaaactcgacgacccgcgcctgaaaggctatttccgg
gcggaagtgctggagcggctgcatggccagatccaattgctgtggaagaccgacgaagtc
cgcgcccgcggcatgggcgtagtcgacgaaatcgacgccggtttgtactactttccgctg
tcgttgttcgaagccaccgccagggtttaccgcaatttccagcgcgccctgcacgacgtc
tacggcaccgacgccgccgcagtcaaaatccccaatttcctcgtgttcggttcctggatc
ggcggcgaccgcgacggcaaccccaacgtcaaaccggaaacgaccgcattggcactgcgt
atgcagacccgtaccgtgttacgggcctacattacccgggtagccgcgctacgcgagcaa
ctatcctactcctacggcttgtgccgacccaccgacgcttttttgcaaagcctgcaacac
gagcgcgagttgctgggcgatgtcgccattgcgttggagcgtagctgccgccaggaaccg
taccggcacaaactcagcctgatgaaataccggttggaagcggcattgaaccgggtcgaa
cagcgtatagaacaaagctccggcgccggcgacattcacgcctatgccggcgccccgcag
tttttagccgatttgcatttgatccgagaatccctgatcagccacggcgaccaagcggtg
gctgacttggaattgctggatctgatccgcttggtcgagaccttcggctttcatctgatg
cagcttgacgtgcgccaggaatcgacccggcacagcgacgcggtggcggaaatctttgcg
ctggcgctgcaaatcgactaccaggccctggcagagtccgaacgcttgcagttattgggc
gaagcgatctcggcccccggcagcttgagctacgacaaccagttgttgagcgaggccacc
cgggaaaccctggaagtatttcaagtgatggccgatatgcgccgggaaatcggcgccgac
tgcttcagccgctacgtgatttcgatgacccactcggccagccacatcatggaggtcttg
ctgctagccgcgcaaaccggcctggccggccgcatcggcgggcgctggtattgccacgtc
ggcgtctcgccgttattcgagactatcgaagatttgagccatatcgacacggttttgcgt
accctgctggcgcaaccggtgtatcgcgccttgcaacaggcttacggccaacgccaggaa
gtcatgttgggctattcggattcctgcaaggacggcggcattctggcctcggcctggggc
ttgtaccgggcgcaacaactggtcatggaaatcagcgacagcgaaggcattccctgccgc
ttgttccacggccgcggcggtaccgttggccgcggcggcgggccgacccatcaggcgatt
ctggcgcaaccgccggccaccgtgcgcggccaaatcaaattcaccgaacagggcgaagtg
ctgttttaccgctacaacaacatggagaccgcagtctacgaattgacgatgggcattacc
ggcctgatgaaagccagtgtcagcctggtccggcccgtcgcaaccgaccagccggaagcg
ctgacgatcatgagcgaattggcggcaatcggtgagcgcggctaccggcaattgaccgag
catacgcccggctttttggactatttttacgaaaccacaccggtcaccgaaatcggccag
cttaatatcggttcccggccatcgcaccgtaaaaaacaggatcgctcgaaaaaatcggta
cgggccatcgcctgggtcttcgcctgggcccaatcccggcaaaccttcccggcctggtac
ggcatcggctccagcttggaaaactggtgcgccggcaagccggagcggctgaaaacctta
cgcgagctatattgcacctggccgttcttccgcaatctgctcagcaacgcacaaatggcg
ttgagcaagtcggacatggacatcgcccgcgagtacgctgcgttgtgcgccgatccggaa
gtcggcaagcgcatccacggcttgatcgccgccgagcaccgacgttgcgtggactggatt
ctggaaatcgccgaaagcgacaggctattggccgataatccggaactggcggcgtcgctg
aaccggcgtaacgattatctcggtccgttgaattttttgcaggccgacctgctgcgggcg
ctacgccaagccgacgagaacgacggcgacatcccggccatgcaacccttgctgcgcacc
atcaacgccattgccgccgggatgcgcaacaccggttag

DBGET integrated database retrieval system