KEGG   Methylomonas koyamae: MKLM6_2714Help
Entry
MKLM6_2714        CDS       T05118                                 

Definition
(GenBank) N-acetyl-gamma-glutamyl-phosphate reductase
  KO
K00145  N-acetyl-gamma-glutamyl-phosphate reductase [EC:1.2.1.38]
Organism
mko  Methylomonas koyamae
Pathway
mko00220  Arginine biosynthesis
mko01100  Metabolic pathways
mko01110  Biosynthesis of secondary metabolites
mko01210  2-Oxocarboxylic acid metabolism
mko01230  Biosynthesis of amino acids
Module
mko_M00028  Ornithine biosynthesis, glutamate => ornithine
Brite
KEGG Orthology (KO) [BR:mko00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00220 Arginine biosynthesis
    MKLM6_2714
Enzymes [BR:mko01000]
 1. Oxidoreductases
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.1  With NAD+ or NADP+ as acceptor
    1.2.1.38  N-acetyl-gamma-glutamyl-phosphate reductase
     MKLM6_2714
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Semialdhyde_dh Semialdhyde_dhC GFO_IDH_MocA zf_C2H2_6
Motif
Other DBs
NCBI-ProteinID: ATG90925
UniProt: A0A291IKL4
LinkDB All DBs
Position
complement(3065889..3066920)
Genome map
AA seq 343 aa AA seqDB search
MVRAGIVGGTGYTGVELLRILVLHPQVEVSVVTSRADAGSRVDQLYPSLRGYCDLQFSPP
ELKYLQGCDVVFFATPNGTAMLMAEALLALGVKVIDLSADFRIKDPAEWEKWYGMQHASP
GLIDEAVYGLPELNRELIKQARLIACPGCYPTAVQLGFLPLLEAGMVDTNGLVADVKSGV
SGAGRKAEIASLMSEAGESFKAYAVAGHRHLPEIKQGLARVAGDEVGLTFVPHLTPMIRG
IHATLYARLNSRGKDLQALFEQRYREQRFVDVLPAGSHADTRNVRGSNRCQIAVHQPQGG
DTVVVLSVIDNLVKGASGQAVQNMNLMFGLAEAAGLETVALYP
NT seq 1032 nt NT seq  +upstreamnt  +downstreamnt
atggtacgagcaggcattgtcggcggcacgggatataccggtgtcgaattattgagaatt
ctggttttgcatccgcaagttgaagtcagcgtcgttacctcccgcgccgacgccgggtcg
agggtggaccagttgtatccaagcctacgcggctattgcgatttgcaattcagtccgccg
gagctgaagtatttgcaaggctgcgatgtggtgttcttcgctacgccgaacggcacagcc
atgctgatggccgaagcgttgttggcgctgggtgtcaaagtcatcgacctgtcggccgat
tttcgtatcaaagacccggccgaatgggagaaatggtacggcatgcagcacgccagtccg
ggcctgattgatgaggccgtgtacggtttgccggagctgaaccgggagctgatcaaacag
gcgcgcttgatcgcttgtccgggctgttacccgactgccgtgcaattgggcttcctgcct
ttgctggaggccggtatggtggatacgaacggcttggtggcggatgtcaaatccggcgtc
agcggtgccggacgcaaagcggaaatagcgtcgctaatgagcgaagccggcgaaagtttc
aaggcctacgcggttgccggccatcgccatttgccggaaatcaagcagggattggcgcgc
gtcgcgggcgacgaggtgggattgacctttgtgccgcatttgacgccgatgatacgcggc
atacacgccacgctttatgcgcgtttaaacagccgtggtaaagatttacaggcacttttc
gagcaacgttatcgggaacagcgcttcgtcgacgtattgcctgccggtagccatgccgac
acccgcaacgtgcgcggcagcaaccgctgccaaattgcggtgcatcaaccgcagggcggc
gatacggtggtggttttgtcggtgatcgacaatctggtgaagggcgcttcgggacaggcg
gtgcagaatatgaacttgatgtttggtttggctgaggcggcaggccttgaaacggttgcg
ctttatccttga

DBGET integrated database retrieval system