KEGG   Methylomonas koyamae: MKLM6_2715Help
Entry
MKLM6_2715        CDS       T05118                                 

Definition
(GenBank) NAD(P)H-quinone oxidoreductase
  KO
K00344  NADPH:quinone reductase [EC:1.6.5.5]
Organism
mko  Methylomonas koyamae
Brite
KEGG Orthology (KO) [BR:mko00001]
 09190 Not Included in Pathway or Brite
  09191 Unclassified: metabolism
   99980 Enzymes with EC numbers
    MKLM6_2715
Enzymes [BR:mko01000]
 1. Oxidoreductases
  1.6  Acting on NADH or NADPH
   1.6.5  With a quinone or similar compound as acceptor
    1.6.5.5  NADPH:quinone reductase
     MKLM6_2715
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ADH_zinc_N ADH_zinc_N_2 ADH_N
Motif
Other DBs
NCBI-ProteinID: ATG90926
UniProt: A0A291IL46
LinkDB All DBs
Position
3066998..3067975
Genome map
AA seq 325 aa AA seqDB search
MRAVQIQTTAELDQLVVTDWPKPTPGPNQVLIQTHAAGVNRPDLVQRRGLYPPPPGASPI
LGLEVAGSVAAIGSAVTKVEVGDSVCALVTGGGYAEYCLASACCCLPIPRGFSFTQAAAL
PETFFTVWSNVFDRARLQAGESLLVHGGSSGIGTTAIQLAKAFGARAIATAGSDEKCRRC
LELGADLAVNYRQQDFVEAVLDFTGGKGVNVILDMVGGDYLPRNLKSLASDGRLMQIGIQ
QGSKAEINLAALLMKRLTLAGSTLRSRSDEFKANIAEQLREKVWPLLASGQVKPVIDSVF
PLAEADQAHRLMESSQHIGKIILEL
NT seq 978 nt NT seq  +upstreamnt  +downstreamnt
atgcgtgccgttcagattcaaactaccgccgaactcgaccaactcgtcgtgaccgactgg
ccgaaaccgacgcctgggcccaatcaggttctgatccaaacccacgctgccggcgtcaac
cgccccgacctcgtgcaacgccgaggcctgtatccgccgccgccgggtgcatcgcccatt
cttggcttggaagtcgccggtagcgtcgctgcaatcggcagcgcggtaacgaaagttgag
gtcggcgattcggtctgcgcgctggtcaccggcggcggctatgccgaatattgcctggcc
agcgcctgctgctgtttaccgattccacggggattcagctttacccaggccgcagcgctc
ccggagacattttttaccgtgtggagtaacgttttcgaccgagccagattgcaagccggc
gaatcgctgttggtgcatggcggcagcagcggcatcggcaccaccgcaatccagcttgcc
aaagccttcggcgcccgtgccatcgcgacggcaggcagcgacgagaaatgccggcggtgt
ctggagttgggcgccgaccttgccgtaaattaccggcaacaggatttcgtcgaagccgta
ttggactttaccggcggtaaaggcgtaaacgtgattctggatatggtaggcggggattat
ctgccacgtaatttaaaatcgctggcaagcgacggccgactgatgcaaatcgggattcag
caaggcagcaaggccgaaatcaatttggccgcgctgctgatgaaacgtctgacgctggcc
ggttccaccttacgttcccgcagcgacgagttcaaagccaacatcgcagagcagttacgc
gagaaagtctggccattgttggcatccggccaagtcaaacccgtgatagattctgtgttt
ccgctggccgaggccgaccaggcccaccggctgatggaaagcagccaacacatcggaaaa
attattctggagctatga

DBGET integrated database retrieval system