KEGG   Methylomonas koyamae: MKLM6_3089Help
Entry
MKLM6_3089        CDS       T05118                                 

Definition
(GenBank) 3-hydroxyacyl-ACP dehydratase
  KO
K02372  3-hydroxyacyl-[acyl-carrier-protein] dehydratase [EC:4.2.1.59]
Organism
mko  Methylomonas koyamae
Pathway
mko00061  Fatty acid biosynthesis
mko00780  Biotin metabolism
mko01100  Metabolic pathways
mko01212  Fatty acid metabolism
Module
mko_M00083  Fatty acid biosynthesis, elongation
Brite
KEGG Orthology (KO) [BR:mko00001]
 09100 Metabolism
  09103 Lipid metabolism
   00061 Fatty acid biosynthesis
    MKLM6_3089
  09108 Metabolism of cofactors and vitamins
   00780 Biotin metabolism
    MKLM6_3089
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01004 Lipid biosynthesis proteins [BR:mko01004]
    MKLM6_3089
Enzymes [BR:mko01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.59  3-hydroxyacyl-[acyl-carrier-protein] dehydratase
     MKLM6_3089
Lipid biosynthesis proteins [BR:mko01004]
 Fatty acid synthase
  Component type
   MKLM6_3089
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: FabA PS-DH 4HBT MaoC_dehydratas
Motif
Other DBs
NCBI-ProteinID: ATG91288
UniProt: A0A291IM54
LinkDB All DBs
Position
complement(3503493..3503936)
Genome map
AA seq 147 aa AA seqDB search
MAGTLDILQIQKLLPHRYPFLLVDKVVACEPSASLTALKNVTFNEPFFQGHFPSQPIMPG
VLIMEALAQATALLTSQSDDKVGEGAVYYLAGIDNARFKRQVVPGDQLRLQVTYLKHKRH
LWSFDCRAEVDGELAASAQIMCAVSVA
NT seq 444 nt NT seq  +upstreamnt  +downstreamnt
atggccggaacactcgatattctgcagattcagaaattattgccgcatcgttatccattc
ttgttggtggataaagtggtcgcttgcgagcctagcgccagcttgacggctttaaaaaac
gtcaccttcaacgagccgttttttcagggccattttcccagccagcctatcatgcccggc
gtattgattatggaagcgctggcgcaggctacggcgttgctgacttcgcaaagcgacgac
aaggtgggcgagggtgccgtctattatttggccggcatcgacaatgcccgcttcaaacgc
caagtggtgcctggagaccaattgcgcttgcaggttacttacctgaagcacaagcgccat
ttgtggtcgttcgactgccgggccgaggtcgacggcgaactggcggccagcgcccagatc
atgtgcgcggtgtcggtggcttaa

DBGET integrated database retrieval system