KEGG   Mycobacterium kansasii 662: LG40_15750Help
Entry
LG40_15750        CDS       T03652                                 

Gene name
katE
Definition
(GenBank) hydroperoxidase
  KO
K03781  catalase [EC:1.11.1.6]
Organism
mks  Mycobacterium kansasii 662
Pathway
mks00380  Tryptophan metabolism
mks00630  Glyoxylate and dicarboxylate metabolism
mks01110  Biosynthesis of secondary metabolites
mks01130  Biosynthesis of antibiotics
mks01200  Carbon metabolism
Brite
KEGG Orthology (KO) [BR:mks00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00630 Glyoxylate and dicarboxylate metabolism
    LG40_15750 (katE)
  09105 Amino acid metabolism
   00380 Tryptophan metabolism
    LG40_15750 (katE)
Enzymes [BR:mks01000]
 1. Oxidoreductases
  1.11  Acting on a peroxide as acceptor
   1.11.1  Peroxidases
    1.11.1.6  catalase
     LG40_15750 (katE)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Catalase Catalase-rel DJ-1_PfpI
Motif
Other DBs
NCBI-ProteinID: AIR19361
UniProt: X7Z4E7
LinkDB All DBs
Position
3432626..3434737
Genome map
AA seq 703 aa AA seqDB search
MAANDSNPKQRQLDDCRLDGSTGYLTTQQGVRVDHTDDALTAGERGPTLLEDFHAREKIT
HFDHERIPERVVHARGAGAYGYFEPYDDWLAEYTAAKFLTTPGKQTPVFVRFSTVVGSRG
SADTVRDVRGFATKFYTDQGNYDLVGNNFPVFFIQDGIKFPDLVHAVKPEPHNEIPQAQS
AHDTLWDFVSLQPETLHTIMWLMSDRALPRSYRMMEGFGVHTFRLVNADGQGTFVKFHWK
PRLGVHSLVWEECQKVAGKDPDFNRRDLWEAIEAGQYPEWEFGVQLVPESDEFNFGFDLL
DATKIIPEEQVPVRPVGKMVLNRNPDNFFAETEQVAFHTANVVPGIDFTNDPLLQFRNFS
YLDTQLIRLGGPNFAQLPVNRPVAEVHNNQRDGYGQHTIPRGRSSYYNNSLGGGCPALAD
DNVFRHYTQKVDGHKIRQRAESFQDHYSQARMFWKSMSAVEAKHIVAAYAFELGKVETPE
IRSRVVDQLNRVDHDLATRVAGELGLPAPEGTDKLGAEMPPSPALSQLNTATDSVETRKI
AVLAADGVDVVGTQTFIEAMRQRGAIVEVLAPRAGGMLSGGSGGELPVDRAITTMSSVLY
DAVVIPCGPDAVKALSEDGYVMHFVTEAYKHLKAVGAFGAGVKLLPKAGITEKTAESTDA
FVSNGVITTKAAADDLSDDFAEAFAKVLAKHRVWERQTDSVPA
NT seq 2112 nt NT seq  +upstreamnt  +downstreamnt
atggcagccaacgactccaacccgaagcaacgacagcttgacgactgccggctagacggg
agcaccggatacctgaccacgcagcagggcgtgcgagtggaccataccgacgatgcactt
accgcgggggagcgtgggcccaccctgctcgaggacttccatgcccgggaaaagatcacc
cacttcgatcacgagcgcatccccgaacgagtggtacacgcccgcggggccggagcatac
ggatacttcgagccctatgacgattggcttgccgaatacaccgcggcgaaattcctcacc
acgccgggtaagcagacgccggtcttcgtccggttttccaccgtcgtgggatctcgcggc
tcggcggacaccgtgcgcgatgtccgcggattcgccaccaagttctacaccgaccagggc
aactacgacctggtgggcaacaacttcccggtgttcttcatccaggacggcatcaagttc
ccggatttggtgcacgcggttaaacccgagccacacaacgagattccgcaggcgcagtcg
gcccacgacacgctgtgggacttcgtgtcgctgcagccggagacgctgcacaccatcatg
tggctgatgtcggaccgggcgctgccgcgcagttaccgaatgatggagggcttcggcgtg
cacaccttccgcctggtcaacgccgacggccagggcactttcgtgaagtttcattggaag
ccacgccttggcgtgcattcgctggtgtgggaggagtgccagaaggtggccggcaaggac
cccgacttcaaccggcgcgacctgtgggaagccatcgaggccggccaatatccggagtgg
gagttcggggtgcagctggttccggaaagcgacgagttcaacttcggcttcgacctgctc
gacgccaccaaaatcattccggaggaacaggttccggtacgtccggtgggcaagatggtg
ctcaaccgcaacccggacaacttcttcgccgaaaccgagcaggtggcgttccacaccgcc
aacgtggtgcccggcatcgacttcaccaacgacccactgctgcagttccgcaacttctcc
tacctcgacacccagctgatcaggttgggcggccccaatttcgcgcaactgccggtcaat
cggccggtggccgaggtgcacaacaaccagcgcgacggctacggccagcacaccattcca
cgcggccggtcaagctactacaacaacagccttggcggcggctgtccggccctggcagac
gacaacgtgttccgccactacacccagaaggtcgacggtcacaagatccgccagcgggcc
gaaagcttccaggatcactacagccaggcccggatgttctggaagagcatgtctgccgtc
gaggccaaacacattgtcgccgcgtacgccttcgagctcggcaaggtggaaacaccggaa
atccgttcgcgcgtcgtggatcagctgaaccgcgtcgaccatgacctggcgacccgcgtc
gccggggagctggggctgcccgcgcccgaaggaacggacaagctgggcgccgaaatgccc
ccctccccggcgctttcgcaactcaataccgccaccgacagcgtcgaaacacgcaagatc
gccgtgctggccgccgacggcgtcgacgtggtgggcacccagaccttcatcgaggcgatg
cggcagcgcggggccatcgtagaagtgttggcgcccagggccggtggcatgctgtccggc
ggatccggcggcgaactcccggtggaccgggcgatcaccacgatgtcgtcggtcctctac
gacgcggtcgtgataccgtgcggacccgacgccgtcaaggccctgtccgaagacggctac
gtgatgcatttcgtcaccgaggcctacaaacacctcaaggcggtgggggctttcggtgcg
ggcgtcaagttactgcccaaggccgggataaccgagaaaaccgccgagagcaccgacgcc
ttcgtctccaacggggtgatcacgaccaaggctgcggccgacgacctatccgacgacttc
gccgaggcattcgccaaagtgcttgccaaacaccgtgtttgggagcgacagaccgatagc
gtgcccgcctga

DBGET integrated database retrieval system