KEGG   Mycobacterium kansasii 662: LG40_17170Help
Entry
LG40_17170        CDS       T03652                                 

Definition
(GenBank) aminotransferase
  KO
K14260  alanine-synthesizing transaminase [EC:2.6.1.66 2.6.1.2]
Organism
mks  Mycobacterium kansasii 662
Pathway
mks00220  Arginine biosynthesis
mks00250  Alanine, aspartate and glutamate metabolism
mks00290  Valine, leucine and isoleucine biosynthesis
mks01100  Metabolic pathways
mks01110  Biosynthesis of secondary metabolites
mks01130  Biosynthesis of antibiotics
mks01210  2-Oxocarboxylic acid metabolism
mks01230  Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:mks00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    LG40_17170
   00290 Valine, leucine and isoleucine biosynthesis
    LG40_17170
   00220 Arginine biosynthesis
    LG40_17170
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01007 Amino acid related enzymes [BR:mks01007]
    LG40_17170
Enzymes [BR:mks01000]
 2. Transferases
  2.6  Transferring nitrogenous groups
   2.6.1  Transaminases
    2.6.1.2  alanine transaminase
     LG40_17170
    2.6.1.66  valine---pyruvate transaminase
     LG40_17170
Amino acid related enzymes [BR:mks01007]
 Aminotransferase (transaminase)
  Class I
   LG40_17170
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Aminotran_1_2 DegT_DnrJ_EryC1 Aminotran_5 Cys_Met_Meta_PP Beta_elim_lyase Aminotran_3
Motif
Other DBs
NCBI-ProteinID: AIR19617
LinkDB All DBs
Position
complement(3750769..3752058)
Genome map
AA seq 429 aa AA seqDB search
MDSDETMVDVTTHQLPWHASAHHRQRTFAQSSKLQDVLYEIRGPVHQHAARLEAEGHRIL
KLNIGNPAPFGFEAPDVIMRDMIQALPYAQGYSDSQGILSARRAVVTRYELVEGFPRFDV
DDVYLGNGVSELITMTLQALLDNGDQVLIPSPDYPLWTASTSLAGGTPVHYLCDETQSWQ
PDIADLESKITDRTKALVVINPNNPTGAVYSREILTQMVDLARKHQLLLLADEIYDKILY
DDAKHISVASLAHDMLCLTFNGLSKAYRVAGYRAGWLAITGPKDHASSFIEGISLLANMR
LCPNVPAQHGIQVALGGHQSIEDLVLPGGRLLEQRDVAWTKLNEIPGVSCVKPAGALYAF
PRLDPEVYDIADDEELVLDLLLSEKILVTQGTGFNWPAPDHLRLVTLPWSRDLAAAIERL
GNFLVSYRQ
NT seq 1290 nt NT seq  +upstreamnt  +downstreamnt
ctggacagcgatgagaccatggttgacgtgactactcaccagctgccctggcacgcctcc
gcacatcatcggcagcgcaccttcgcgcagtcgtccaagctgcaggacgtcctgtacgaa
atccgcggcccggtacaccaacacgccgcgcggctggaagccgaaggtcaccgcatcctc
aagctcaacatcggcaacccggcgccgttcggtttcgaggcgcccgacgtgatcatgcgt
gacatgatccaagcgctgccctacgcccagggatactccgactctcagggcattttgtcg
gcccgccgtgcggtggtcacccgctacgagctggtcgagggcttcccgcgattcgacgtc
gacgacgtctatttgggcaacggggtgtccgagctgatcaccatgacgttgcaggccctg
ctggacaacggcgatcaggtgttgatcccgtcaccggactacccactgtggacggcgtcg
acctcgctggccggcggcacgcccgtgcactacctctgcgacgagacccagagctggcag
cccgacatcgccgacctggaatccaagatcaccgaccgcaccaaggccctggtcgtgatc
aacccgaacaaccccaccggtgcggtctacagccgcgaaatcctcacccagatggtcgat
ttggcgcgcaagcatcaactgctgctgctcgccgacgagatctacgacaagatcctctac
gacgacgccaaacacatcagcgtggcctcgctcgcccacgacatgttgtgcctgaccttc
aacggtctgtccaaggcataccgggtcgccggataccgggccggctggctggcgatcacc
gggcccaaagaccacgccagcagcttcatcgagggcatcagtctgctggccaacatgcgg
ctgtgcccaaatgtcccggcgcagcacggaattcaggtcgccctcggcggacaccagagc
atcgaggatctagtgcttcccggcggccggctgctcgagcagcgcgacgttgcctggacc
aagctcaatgagattcccggggtctcgtgtgtcaagccggccggcgcgctgtacgcgttt
ccccgattggaccctgaggtctacgacatcgccgacgacgaggaactcgtcctggacctc
ttgctgtccgagaaaattctggtcacccagggcaccggattcaattggccggcacccgat
cacctgcgcctggtgacattgccgtggtctcgtgatcttgccgccgcgatcgagcggctg
ggtaacttcctggtcagctaccgccagtag

DBGET integrated database retrieval system