KEGG   Mycobacterium kansasii 662: LG40_17170Help
Entry
LG40_17170        CDS       T03652                                 

Definition
(GenBank) aminotransferase
  KO
K14260  alanine-synthesizing transaminase [EC:2.6.1.66 2.6.1.2]
Organism
mks  Mycobacterium kansasii 662
Pathway
mks00290  Valine, leucine and isoleucine biosynthesis
mks01100  Metabolic pathways
mks01110  Biosynthesis of secondary metabolites
mks01130  Biosynthesis of antibiotics
mks01210  2-Oxocarboxylic acid metabolism
mks01230  Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:mks00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    LG40_17170
   00290 Valine, leucine and isoleucine biosynthesis
    LG40_17170
   00220 Arginine biosynthesis
    LG40_17170
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01007 Amino acid related enzymes [BR:mks01007]
    LG40_17170
Enzymes [BR:mks01000]
 2. Transferases
  2.6  Transferring nitrogenous groups
   2.6.1  Transaminases
    2.6.1.2  alanine transaminase
     LG40_17170
    2.6.1.66  valine---pyruvate transaminase
     LG40_17170
Amino acid related enzymes [BR:mks01007]
 Aminotransferase (transaminase)
  Class I
   LG40_17170
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Aminotran_1_2 DegT_DnrJ_EryC1 Aminotran_5 Cys_Met_Meta_PP Beta_elim_lyase Aminotran_3
Motif
Other DBs
NCBI-ProteinID: AIR19617
LinkDB All DBs
Position
complement(3750769..3752058)
Genome map
AA seq 429 aa AA seqDB search
MDSDETMVDVTTHQLPWHASAHHRQRTFAQSSKLQDVLYEIRGPVHQHAARLEAEGHRIL
KLNIGNPAPFGFEAPDVIMRDMIQALPYAQGYSDSQGILSARRAVVTRYELVEGFPRFDV
DDVYLGNGVSELITMTLQALLDNGDQVLIPSPDYPLWTASTSLAGGTPVHYLCDETQSWQ
PDIADLESKITDRTKALVVINPNNPTGAVYSREILTQMVDLARKHQLLLLADEIYDKILY
DDAKHISVASLAHDMLCLTFNGLSKAYRVAGYRAGWLAITGPKDHASSFIEGISLLANMR
LCPNVPAQHGIQVALGGHQSIEDLVLPGGRLLEQRDVAWTKLNEIPGVSCVKPAGALYAF
PRLDPEVYDIADDEELVLDLLLSEKILVTQGTGFNWPAPDHLRLVTLPWSRDLAAAIERL
GNFLVSYRQ
NT seq 1290 nt NT seq  +upstreamnt  +downstreamnt
ctggacagcgatgagaccatggttgacgtgactactcaccagctgccctggcacgcctcc
gcacatcatcggcagcgcaccttcgcgcagtcgtccaagctgcaggacgtcctgtacgaa
atccgcggcccggtacaccaacacgccgcgcggctggaagccgaaggtcaccgcatcctc
aagctcaacatcggcaacccggcgccgttcggtttcgaggcgcccgacgtgatcatgcgt
gacatgatccaagcgctgccctacgcccagggatactccgactctcagggcattttgtcg
gcccgccgtgcggtggtcacccgctacgagctggtcgagggcttcccgcgattcgacgtc
gacgacgtctatttgggcaacggggtgtccgagctgatcaccatgacgttgcaggccctg
ctggacaacggcgatcaggtgttgatcccgtcaccggactacccactgtggacggcgtcg
acctcgctggccggcggcacgcccgtgcactacctctgcgacgagacccagagctggcag
cccgacatcgccgacctggaatccaagatcaccgaccgcaccaaggccctggtcgtgatc
aacccgaacaaccccaccggtgcggtctacagccgcgaaatcctcacccagatggtcgat
ttggcgcgcaagcatcaactgctgctgctcgccgacgagatctacgacaagatcctctac
gacgacgccaaacacatcagcgtggcctcgctcgcccacgacatgttgtgcctgaccttc
aacggtctgtccaaggcataccgggtcgccggataccgggccggctggctggcgatcacc
gggcccaaagaccacgccagcagcttcatcgagggcatcagtctgctggccaacatgcgg
ctgtgcccaaatgtcccggcgcagcacggaattcaggtcgccctcggcggacaccagagc
atcgaggatctagtgcttcccggcggccggctgctcgagcagcgcgacgttgcctggacc
aagctcaatgagattcccggggtctcgtgtgtcaagccggccggcgcgctgtacgcgttt
ccccgattggaccctgaggtctacgacatcgccgacgacgaggaactcgtcctggacctc
ttgctgtccgagaaaattctggtcacccagggcaccggattcaattggccggcacccgat
cacctgcgcctggtgacattgccgtggtctcgtgatcttgccgccgcgatcgagcggctg
ggtaacttcctggtcagctaccgccagtag

DBGET integrated database retrieval system