KEGG   Mycobacterium kansasii 662: LG40_19975Help
Entry
LG40_19975        CDS       T03652                                 

Definition
(GenBank) alanine racemase
  KO
K01775  alanine racemase [EC:5.1.1.1]
Organism
mks  Mycobacterium kansasii 662
Pathway
mks00473  D-Alanine metabolism
mks01100  Metabolic pathways
mks01502  Vancomycin resistance
Brite
KEGG Orthology (KO) [BR:mks00001]
 Metabolism
  Metabolism of other amino acids
   00473 D-Alanine metabolism
    LG40_19975
 Human Diseases
  Drug resistance
   01502 Vancomycin resistance
    LG40_19975
Enzymes [BR:mks01000]
 5. Isomerases
  5.1  Racemases and epimerases
   5.1.1  Acting on amino acids and derivatives
    5.1.1.1  alanine racemase
     LG40_19975
Peptidoglycan biosynthesis and degradation proteins [BR:mks01011]
 Precursor biosynthesis
  Racemase
   LG40_19975
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Ala_racemase_N Ala_racemase_C
Motif
Other DBs
NCBI-ProteinID: AIR20124
LinkDB All DBs
Position
4356704..4357882
Genome map
AA seq 392 aa AA seqDB search
MAVTPISRTPGVLAEAVVDLGAVEHNVRVLREHAGSAQVMAVVKADGYGHGATRVAQAAL
AAGAAELGVATVDEALALRADGITAPVLAWLHPPGIDFGPALVADVEIAVSSTRQLDELL
DAVARTGRTATVSVKVDTGLNRNGVPPALYPEMLARLRQAAAEHAIRLRGLMSHLVYADA
PQQPINDIQAQRFRDMLSYAREEGVTFEVAHLSNSSATMARPDLTLDLVRPGIAVYGLSP
VPERGEMGLVPAMTVKCAVALIKSVPAGEGVSYGHTWIAPHDTTVALLPIGYADGVFRSL
GGRLEVLINGRRRPGVGRICMDQFVVDLGPGPVDVAEGDEAILFGPGARGEPTAQDWADL
VGTIHYEVVTSPRGRISRTYLEAETVESQRIP
NT seq 1179 nt NT seq  +upstreamnt  +downstreamnt
ttggccgttacgccgatatcccggacaccgggcgtcctggccgaggccgtggtcgacctg
ggcgccgtcgagcacaacgtgcgggtgttacgcgagcacgccggaagcgcgcaggtcatg
gccgtcgtcaaggccgacggctacggccacggcgcgaccagggtcgctcaagctgcgttg
gctgcgggggcagccgaactcggcgtcgccaccgtcgacgaggcgctggcgttgcgcgcc
gacggcatcaccgcgccggtgctggcctggctccatccgcccggtattgatttcggtccg
gcgctggttgccgacgtcgaaatcgcggtctcgtcgacgcgtcagctcgacgagctgctg
gatgcggtggcccgtaccggccggacggcaacggtgagcgtcaaggtcgacacgggcctc
aaccgcaacggcgtgccgccggcgctgtacccggagatgctggccaggttgcgtcaggcc
gctgccgagcatgcgatccggctgcgggggctgatgtcgcacctggtgtacgcggacgca
ccgcaacagcccatcaatgacattcaggcccaacggttccgggacatgctgtcgtacgcc
cgtgaagagggcgtcaccttcgaggtggcgcacctgtccaattcgtcggcgaccatggcc
cgtccggatctgaccctcgatctggtgcgtccgggcatcgcggtgtacgggttgagcccg
gtacctgagcggggggagatgggcctggtgccggccatgaccgtgaaatgcgctgtggcg
ctgatcaagtcggttcccgcaggagagggcgtgtcgtacgggcacacctggatcgcgccg
cacgacaccacggtggcgctgctgccgatcggttacgccgatggcgtgttccggtcgctg
ggcgggcgtctcgaggtgctgatcaacggccggcgacgaccgggcgtcggcaggatctgc
atggaccagttcgtcgtcgacctcggccccggcccggtcgacgtggccgaaggtgacgag
gccattctgttcgggcccggcgcccggggcgagcccaccgcgcaggactgggccgatctg
gtgggcaccatccactacgaagtggtaaccagtccgcggggacggatcagcaggacctat
ctcgaggctgaaaccgttgaatcccaacgaatcccatag

DBGET integrated database retrieval system