KEGG   Mycobacterium kansasii 662: LG40_25910Help
Entry
LG40_25910        CDS       T03652                                 

Definition
(GenBank) 4-aminobutyrate aminotransferase
  KO
K07250  4-aminobutyrate aminotransferase / (S)-3-amino-2-methylpropionate transaminase [EC:2.6.1.19 2.6.1.22]
Organism
mks  Mycobacterium kansasii 662
Pathway
mks00250  Alanine, aspartate and glutamate metabolism
mks00280  Valine, leucine and isoleucine degradation
mks00410  beta-Alanine metabolism
mks00640  Propanoate metabolism
mks00650  Butanoate metabolism
mks01100  Metabolic pathways
mks01120  Microbial metabolism in diverse environments
Module
mks_M00027  GABA (gamma-Aminobutyrate) shunt
Brite
KEGG Orthology (KO) [BR:mks00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00640 Propanoate metabolism
    LG40_25910
   00650 Butanoate metabolism
    LG40_25910
  09105 Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    LG40_25910
   00280 Valine, leucine and isoleucine degradation
    LG40_25910
  09106 Metabolism of other amino acids
   00410 beta-Alanine metabolism
    LG40_25910
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01007 Amino acid related enzymes [BR:mks01007]
    LG40_25910
Enzymes [BR:mks01000]
 2. Transferases
  2.6  Transferring nitrogenous groups
   2.6.1  Transaminases
    2.6.1.19  4-aminobutyrate---2-oxoglutarate transaminase
     LG40_25910
    2.6.1.22  (S)-3-amino-2-methylpropionate transaminase
     LG40_25910
Amino acid related enzymes [BR:mks01007]
 Aminotransferase (transaminase)
  Class III
   LG40_25910
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Aminotran_3
Motif
Other DBs
NCBI-ProteinID: AIR21173
UniProt: X7ZRU1
LinkDB All DBs
Position
complement(5698537..5699886)
Genome map
AA seq 449 aa AA seqDB search
MASLEQTRHLVTEIPGPASLELNKRRVAAVSSGVGVMLPVFVVRAGGGILEDADGNRLID
LGSGIAVTTIGNSHPKVVDAVREQVAEFTHTCFMVTPYEQYVAVAEQLNRITPGSGEKRS
ALFNSGAEAVENAIKIARAYTRKPAVVAFDHAYHGRTNMTMALTAKSMPYKSGFGPFAPE
IYRAPLSYPYRDGLLDKELATDGELAAARTISVIDKQVGASNLAAVIIEPIQGEGGFIVP
ADGFLPALLDWCRSNDVVFIADEVQTGFARTGAMFACEHEGTDGLEPDLIVTAKGIADGL
PLSAVTGRAEIMDAPHASGVGGTFGGNPVACAAALATIETIEREGLVERARQIEQQIMDR
LLRLQVADDRVGDVRGRGAMIALELVKSGTAEPDAELTEKLATAAHRAGVILLTCGMFGN
VIRLLPPLTITDELLAEGLDIMCGILGDL
NT seq 1350 nt NT seq  +upstreamnt  +downstreamnt
gtggccagcctcgagcagacacgccacctggtcaccgaaatcccgggtcccgcatcgctg
gaactgaacaaacggcgggtcgcggcggtgtccagtggtgtaggggtcatgctgccggtg
ttcgtcgtccgcgccggcggggggatcctcgaggatgccgacgggaaccggctcatcgac
ctgggttccgggatcgccgtgacgaccatcggcaattcccatcccaaggtcgtggacgcg
gtgcgcgagcaggtggcggagttcacccacacctgcttcatggtgacgccctacgagcag
tacgtggccgtcgccgaacaactcaaccggatcaccccgggctccggcgagaagcgctcg
gcgctgttcaactccggcgccgaggccgtcgagaacgccatcaagatcgcccgcgcttac
acccgcaagcccgcggtggtcgcgttcgaccacgcgtatcacggccgcaccaacatgacg
atggcgctgaccgccaagtccatgccctacaagagcggcttcggcccgttcgccccggag
atctaccgggctccgctgtcctacccctaccgcgacggactgctcgacaaggagctggcc
accgacggtgaactggccgccgcacggaccatcagcgtcatcgacaagcaggtcggcgcc
agcaacttggccgccgtcatcatcgagcccatccagggcgaaggcggtttcatcgttccc
gccgacgggttcctgcccgcgctgctggactggtgccgcagcaacgacgtcgtcttcatc
gccgacgaggtgcagaccggctttgcccgcaccggcgcgatgttcgcctgcgagcacgag
ggcaccgacggcctggagcccgacctgatcgtcaccgccaagggcatcgccgacggactg
ccgctgtccgcggtgaccggtcgggccgagatcatggatgcaccgcacgccagcggtgtg
ggcggcacgttcggcggcaacccggtcgcgtgtgcggccgcgctggccaccatcgaaacc
atcgaacgtgagggcctggtggaacgggcccggcagatcgagcagcagatcatggaccgg
ttgttgcggctgcaggtggccgacgaccgagtgggcgacgtgcgtggtcgcggcgccatg
atcgccctcgagctggtgaagtccggaaccgccgaacccgacgccgagctgaccgagaaa
ctggccaccgcagcccaccgcgccggggtgatcctgttgacttgcggcatgttcggcaac
gtcatccggctactgccgccgctgaccatcaccgacgagctactggccgaaggcctcgac
atcatgtgcgggatcctgggcgacctctga

DBGET integrated database retrieval system