KEGG   Methanocorpusculum labreanum: Mlab_1214Help
Entry
Mlab_1214         CDS       T00472                                 

Definition
(GenBank) Soluble liver antigen/liver pancreas antigen
  KO
K06868  Sep-tRNA:Cys-tRNA synthetase [EC:2.5.1.73]
Organism
mla  Methanocorpusculum labreanum
Pathway
mla00970  Aminoacyl-tRNA biosynthesis
Brite
KEGG Orthology (KO) [BR:mla00001]
 09120 Genetic Information Processing
  09122 Translation
   00970 Aminoacyl-tRNA biosynthesis
    Mlab_1214
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03016 Transfer RNA biogenesis [BR:mla03016]
    Mlab_1214
Enzymes [BR:mla01000]
 2. Transferases
  2.5  Transferring alkyl or aryl groups, other than methyl groups
   2.5.1  Transferring alkyl or aryl groups, other than methyl groups (only sub-subclass identified to date)
    2.5.1.73  O-phospho-L-seryl-tRNA:Cys-tRNA synthase
     Mlab_1214
Transfer RNA biogenesis [BR:mla03016]
 Prokaryotic type
  Aminoacyl-tRNA synthetases (AARSs)
   Other AARSs
    Mlab_1214
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: SepSecS Aminotran_5 Aminotran_1_2 Beta_elim_lyase Cys_Met_Meta_PP DegT_DnrJ_EryC1
Motif
Other DBs
NCBI-ProteinID: ABN07383
UniProt: A2SSS7
LinkDB All DBs
Position
1244690..1245868
Genome map
AA seq 392 aa AA seqDB search
MKCAGQIEARAVEESSINLDPIQAAGRLTPEAMKAVIAWGDGYSVCDNCHKPFRLDYVTK
PPIADFHEEAAKWLGMDKIQLVPGARRAFQEVTGALVGKGEPVIMTGMGHYTAYLSVEVV
NGVVREIRPTADHHITADAAAESIENAVREFGYAPKLVFVDAVDFMYGNMHEVEKIAKVA
HQYDIPVLYNGVYTVGVLPVDGKKLGVDFVVGSGHKSMAAPAPSGILATTDEYAEIVLRT
TKIQGDITGRKFGIKQVGILGCSLMGDPAVGLIASFPRVKERVNHFDEELKNHKIVTDAL
LSIEGTKVASEYPRKHTLTRMDTAGSFDVIARTHKKRGFFLSSALNKRGITGIMPGVTKQ
WKFNTYGLTKTQAEYLADSFIEIAEENSMVVG
NT seq 1179 nt NT seq  +upstreamnt  +downstreamnt
atgaaatgcgcagggcagatcgaagcccgcgccgtggaagaatcctcgatcaatctcgat
ccgatccaggcggcggggagactcacacccgaagcgatgaaagccgtcatcgcgtggggg
gacggatactccgtctgtgacaactgtcataaacccttccgcctggactatgtgacaaaa
ccgccgatcgcagacttccacgaagaagccgcgaaatggctcgggatggacaagatccag
ctcgtgcccggagcacggcgggcattccaggaagtcaccggggcacttgtcggaaaaggc
gagccggtgatcatgaccgggatggggcattacacggcgtatttgtccgtcgaagttgtg
aacggcgtcgtcagagagatcaggccgacggccgaccaccacatcaccgccgatgccgcc
gccgagtcgatcgaaaacgccgtacgcgaattcggctatgctccaaaactcgtctttgtg
gatgcggtcgattttatgtacggcaacatgcatgaagtcgaaaaaatcgccaaagtcgcc
caccagtacgacatccccgttctctacaacggcgtgtataccgtcggcgttctcccggtt
gacgggaaaaaactcggcgtcgatttcgttgtcggatccgggcacaaaagtatggcggcc
cccgccccgtccgggattcttgcgaccaccgatgagtatgcggagatcgttctccgcaca
acaaagatccaaggggatatcaccggcagaaagttcggcatcaagcaggtcggtatcctc
ggctgttcgctgatgggcgacccggcggtcgggctgatcgcctccttcccgcgggtgaaa
gagcgggtcaaccacttcgacgaggaactgaaaaaccacaagatcgtcaccgacgctctg
ctctcgatcgaaggaacgaaggtcgcgtccgagtatccgcgaaaacacaccctcacccgt
atggatacggcgggatccttcgacgtcatcgcccggacccataaaaaacgcggcttcttc
ctctcgagcgccttaaacaaacgggggatcaccggcatcatgccgggcgtcaccaaacag
tggaagttcaacacctacggactaacgaaaacacaggcagagtatctcgctgattcgttc
atcgagatcgccgaagaaaatagtatggtcgtggggtaa

DBGET integrated database retrieval system